CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.003G076700.1
FamilyGH1
Protein PropertiesLength: 518 Molecular Weight: 59326.1 Isoelectric Point: 5.2559
ChromosomeChromosome/Scaffold: 03 Start: 11955346 End: 11959220
Descriptionbeta glucosidase 46
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1244900
  TFLFGTASSAYQYEGAYSSDGKGLNNWDVFSHRIGSISDGSNGDVAVDQYHRYQEDIDLMEAMKVNSYRFSVSWARILPEGRFGEVNLAGINYYNRLIDA
  LLLKGIQPFVTLFHFDIPQELEDRYGAWLSPQSQEDFQFLADICFKSFGDRVKYWVTFNEPNYIIPLAYRVGQFPPCRCSRKFGDCREGDSEKEPFVVAH
  NMILSHAAAVDIYRNKYQNEQGGKIGIVLHCDSFEPLSNSTADKLATERAQSFSTNWILDPILFGKYPKEMEMILGTILPKFSSNDKAKLRRGLDFIGIN
  YYASYYVRDCISSVCGYGKGVTKTEGSYEQTVLKNGVPIGELTPFDWLNVYPQGMKNVLIYLKDRYNNTPMFITENGYATLYDPDVTEEEYLNDYKRIEF
  MSGHLDNLMAAIKEGADVRGYFVWSLLDNFEWKYGFSAKFGLHHIDHVTLKRTPKLSASWYKRFIEN
Full Sequence
Protein Sequence     Length: 518     Download
MEIMFFLLMC SLTSISLGFD PSPTFLFGTA SSAYQYEGAY SSDGKGLNNW DVFSHRIGSI    60
SDGSNGDVAV DQYHRYQEDI DLMEAMKVNS YRFSVSWARI LPEGRFGEVN LAGINYYNRL    120
IDALLLKGIQ PFVTLFHFDI PQELEDRYGA WLSPQSQEDF QFLADICFKS FGDRVKYWVT    180
FNEPNYIIPL AYRVGQFPPC RCSRKFGDCR EGDSEKEPFV VAHNMILSHA AAVDIYRNKY    240
QNEQGGKIGI VLHCDSFEPL SNSTADKLAT ERAQSFSTNW ILDPILFGKY PKEMEMILGT    300
ILPKFSSNDK AKLRRGLDFI GINYYASYYV RDCISSVCGY GKGVTKTEGS YEQTVLKNGV    360
PIGELTPFDW LNVYPQGMKN VLIYLKDRYN NTPMFITENG YATLYDPDVT EEEYLNDYKR    420
IEFMSGHLDN LMAAIKEGAD VRGYFVWSLL DNFEWKYGFS AKFGLHHIDH VTLKRTPKLS    480
ASWYKRFIEN YIADNIVSKE DEEKRNGNNL RTLVQNL*                            540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02998PLN029984.0e-1263489495+
PLN02814PLN028142.0e-1316492494+
COG2723BglB5.0e-14725490473+
TIGR03356BGL1.0e-16125484460+
pfam00232Glyco_hydro_12.0e-17324490476+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI23186.10448818516unnamed protein product [Vitis vinifera]
RefSeqNP_850968.10349216508BGLU46 (BETA GLUCOSIDASE 46); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana]
RefSeqXP_002305594.102549433500predicted protein [Populus trichocarpa]
RefSeqXP_002305597.102549442511predicted protein [Populus trichocarpa]
RefSeqXP_002518516.101449526508beta-glucosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3gnr_A02548921487A Chain A, Crystal Structure Of Wild-Type E.Coli Gs In Complex With Adp And Glucose(Wtgsb)
PDB3gnp_A02548921487A Chain A, Crystal Structure Of Wild-Type E.Coli Gs In Complex With Adp And Glucose(Wtgsb)
PDB3gno_A02548921487A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB2rgm_B02549024481A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB2rgm_A02549024481A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
Signal Peptide
Cleavage Site
18
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO785819315213300
FG859262235973300
BG0448292351023360
CX6352262911174070
CX7012212632585150
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_012_00117.1Aquca_054_00059.1Aquca_054_00064.2Aquca_054_00061.2Aquca_054_00061.1
Aquca_054_00064.3Aquca_054_00064.1.216.582Aquca_054_00064.1.216.582Aquca_054_00060.1Aquca_054_00064.4
Aquca_054_00061.3Aquca_054_00061.4Aquca_054_00061.5Aquca_054_00061.6
Arabidopsis lyrata475147492699475148
Arabidopsis thalianaAT1G61820.1AT4G21760.1AT1G61810.1AT1G61810.3AT1G61820.3
Brachypodium distachyonBradi5g15540.1Bradi5g15527.1Bradi5g15540.3Bradi5g15540.2
Brassica rapaBra028383Bra031392Bra038756Bra013557Bra038755
Carica papayaevm.model.supercontig_198.21
Capsella rubellaCarubv10021428mCarubv10020143mCarubv10021331mCarubv10006876m
Citrus clementinaCiclev10007996mCiclev10014887mCiclev10017801m
Citrus sinensisorange1.1g009535morange1.1g014339morange1.1g045534morange1.1g016308morange1.1g012716m
orange1.1g016444morange1.1g016438morange1.1g022079m
Cucumis sativusCucsa.341820.2Cucsa.341820.1Cucsa.123340.1Cucsa.086000.1Cucsa.341820.3
Cucsa.341810.1
Eucalyptus grandisEucgr.H00071.1Eucgr.H02855.1Eucgr.E04103.1Eucgr.H02856.1Eucgr.H02856.2
Fragaria vescamrna19575.1-v1.0-hybrid
Glycine maxGlyma15g11290.2Glyma13g35430.2Glyma12g35125.1Glyma07g38840.1Glyma07g38850.1
Glyma12g35140.2Glyma13g35410.2Glyma13g35410.3Glyma13g35410.4
Gossypium raimondiiGorai.010G178500.1Gorai.010G178800.1Gorai.013G167400.1Gorai.013G167400.2Gorai.013G167400.4
Gorai.011G016100.1.462.724Gorai.011G016100.1.462.724Gorai.013G167400.5Gorai.013G167400.3.150.447Gorai.013G167400.3.150.447
Gorai.013G167400.6
Linum usitatissimumLus10018353Lus10007656Lus10007655Lus10032660Lus10018354
Lus10032659
Malus domesticaMDP0000140817MDP0000213598MDP0000306738MDP0000149337
Manihot esculentacassava4.1_005677mcassava4.1_032622mcassava4.1_031147mcassava4.1_026351m
Medicago truncatulaMedtr4g131800.1Medtr4g131810.1
Mimulus guttatusmgv1a004080m
Oryza sativaLOC_Os04g43360.1LOC_Os04g43410.1LOC_Os04g43390.2LOC_Os04g43360.2LOC_Os04g43390.1
LOC_Os04g43400.1LOC_Os04g43380.1
Panicum virgatumPavirv00042435mPavirv00070823mPavirv00006566mPavirv00021804mPavirv00059033m
Pavirv00006565mPavirv00036311mPavirv00010790m
Physcomitrella patensPp1s22_312V6.2Pp1s22_312V6.1
Phaseolus vulgarisPhvul.005G082900.1Phvul.005G082800.3Phvul.005G082800.2Phvul.005G082800.1Phvul.007G273800.1
Phvul.006G151300.1Phvul.003G076800.1Phvul.006G151400.1Phvul.003G076700.2
Picea abiesMA_10431526g0010MA_119280g0010
Populus trichocarpaPotri.004G019800.1Potri.004G019700.1Potri.004G019500.1Potri.004G019300.1Potri.004G019300.2
Potri.001G403900.1Potri.004G019400.1
Prunus persicappa004523mppa025660mppa005194mppa017816m
Ricinus communis29842.m00362929904.m002964
Setaria italicaSi009837mSi009886mSi009882mSi009894mSi009871m
Si009850mSi010127mSi010115mSi010284mSi010346m
Si010332mSi010833m
Sorghum bicolorSb06g022460.1Sb06g022450.1Sb06g022510.1Sb06g022500.1Sb06g022410.1
Sb06g022490.1Sb06g022420.1Sb06g022385.1
Thellungiella halophilaThhalv10024134mThhalv10024920mThhalv10024911mThhalv10023411mThhalv10024896m
Vitis viniferaGSVIVT01014400001GSVIVT01012650001GSVIVT01014399001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)