y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.003G118100.2
FamilyGH1
Protein PropertiesLength: 459 Molecular Weight: 52864.7 Isoelectric Point: 8.7205
ChromosomeChromosome/Scaffold: 03 Start: 29442080 End: 29447292
DescriptionGlycosyl hydrolase superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH133560
  HAQIKLAKDTGVTVFRMGIDWTRIMPVEPVNSLNESVNYAALERYKWIINKVRSYGMKVMLTLFHHSLPPWAGEYGGWKLEKTVDYFMDFTRLVVDSVSD
  SVDYWVTFNEPHVFCMLTYCAGAWPGGHPDMLEVATSALPTGVFQQAMHWMSVAHLKAYDYIHGLSNPLNPIVGVAHHVSFMRPFGLYDVAAVSLANSLT
  LFPYIDGISEKLDYIGINYYGQEVVSGAGLKLVENDEYSESGRGVYPDGLYRMLLQFHERYKHLKIPFIITENGVSDETDLIRRPYFLEHLLAVYAAINM
  GVRVLGYLFWTISDNWEWADGYGPKFGLVAVDRANNLARIPRPSYHLFSKIVNT
Full Sequence
Protein Sequence     Length: 459     Download
MFHAQIKLAK DTGVTVFRMG IDWTRIMPVE PVNSLNESVN YAALERYKWI INKVRSYGMK    60
VMLTLFHHSL PPWAGEYGGW KLEKTVDYFM DFTRLVVDSV SDSVDYWVTF NEPHVFCMLT    120
YCAGAWPGGH PDMLEVATSA LPTGVFQQAM HWMSVAHLKA YDYIHGLSNP LNPIVGVAHH    180
VSFMRPFGLY DVAAVSLANS LTLFPYIDGI SEKLDYIGIN YYGQEVVSGA GLKLVENDEY    240
SESGRGVYPD GLYRMLLQFH ERYKHLKIPF IITENGVSDE TDLIRRPYFL EHLLAVYAAI    300
NMGVRVLGYL FWTISDNWEW ADGYGPKFGL VAVDRANNLA RIPRPSYHLF SKIVNTGKVT    360
REDRERAWDE LQRAAKEKKT RPFYRAVNKH RLMYAGGLDE PVQRPYIDRD WRFGHYQMEG    420
LQDHLSRFSR VIIRPFSPKR KTKSQEKNPK LILQPLET*                           480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR01233lacG1.0e-192334411+
PRK13511PRK135111.0e-256359432+
TIGR03356BGL1.0e-516350388+
pfam00232Glyco_hydro_16.0e-521356414+
COG2723BglB6.0e-656357408+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAJ87636.104458180637putative beta-glycosidase [Glycine max]
EMBLCAJ87637.105456187638putative beta-glycosidase [Solanum lycopersicum]
EMBLCBI22845.104457162616unnamed protein product [Vitis vinifera]
RefSeqXP_002280268.105457191645PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002316058.104455160611predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4ha4_A1e-39936270471A Chain A, Beta-Glycosidase From Pyrococcus Horikoshii
PDB4ha3_A1e-39936270471A Chain A, Structure Of Beta-Glycosidase From Acidilobus Saccharovorans In Complex With Tris
PDB1vff_A6e-39136651415A Chain A, Beta-Glycosidase From Pyrococcus Horikoshii
PDB3apg_D6e-37836268460A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus
PDB3apg_C6e-37836268460A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO8000362841664490
FE6859772621063670
GO841008324193410
CX0459472931063980
HO800036224384590.47
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_073_00022.2Aquca_073_00022.1Aquca_073_00022.3Aquca_073_00022.4
Arabidopsis lyrata477956
Arabidopsis thalianaAT3G06510.1AT3G06510.2
Brachypodium distachyonBradi4g09920.1
Brassica rapaBra040275Bra029584
Capsella rubellaCarubv10013225m
Citrus clementinaCiclev10004508mCiclev10004510mCiclev10004513mCiclev10004514mCiclev10004507m
Ciclev10004684m
Citrus sinensisorange1.1g008043m.64.291orange1.1g008043m.327.475orange1.1g008043m.327.475orange1.1g008043m.64.291orange1.1g008982m
orange1.1g006266morange1.1g006265morange1.1g006252morange1.1g006261morange1.1g011240m
orange1.1g008980m
Cucumis sativusCucsa.246950.2Cucsa.246950.1
Eucalyptus grandisEucgr.H04080.1Eucgr.H04080.2
Fragaria vescamrna05024.1-v1.0-hybrid
Glycine maxGlyma07g36470.2Glyma05g06465.1Glyma17g04130.1
Gossypium raimondiiGorai.006G080700.1Gorai.006G080700.2
Linum usitatissimumLus10043048Lus10011147
Malus domesticaMDP0000187687
Manihot esculentacassava4.1_003404m
Mimulus guttatusmgv1a023966m
Oryza sativaLOC_Os11g45710.1LOC_Os11g45710.2LOC_Os11g45710.3LOC_Os11g45710.4LOC_Os11g45710.5
LOC_Os11g45710.6LOC_Os11g45710.7
Panicum virgatumPavirv00063330mPavirv00063329mPavirv00005855m
Physcomitrella patensPp1s37_35V6.1Pp1s25_336V6.1
Phaseolus vulgarisPhvul.003G118100.1
Picea abiesMA_36535g0010MA_10436797g0010MA_194231g0010MA_10111401g0010MA_7936147g0010
Populus trichocarpaPotri.010G149500.3Potri.010G149500.1Potri.010G149500.2
Prunus persicappa002585m
Ricinus communis29889.m003347.69.28529889.m003347.319.46729889.m003347.319.46729889.m003347.69.285
Setaria italicaSi026098mSi026096m
Selaginella moellendorffii110274935
Sorghum bicolorSb05g026810.3Sb05g026810.2Sb05g026810.1
Thellungiella halophilaThhalv10020302m
Vitis viniferaGSVIVT01034947001
Zea maysAC148152.3_FGT008
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny