y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.003G140700.1
FamilyGH47
Protein PropertiesLength: 580 Molecular Weight: 66046.3 Isoelectric Point: 4.8355
ChromosomeChromosome/Scaffold: 03 Start: 33400833 End: 33405983
Descriptionalpha-mannosidase 1
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH471175480
  AMLHAWTSYETYAWGRDELKPQSKNGVDNFGGLGATLVDSLDTLFIMGLDDQFNRAREWVAESLSFDKNIEVSVFETTIRVMGGLLSAYDLSGDNVFLEK
  ARDIADKLLPAWNTPSGIPYNRINLASGSTNNPAWARGSSILADSGSEQLEFIALSQRTKDPKYQENAEKVIKELHENFPDDGLLPIYLNPLTGTKTGGS
  ITFGAMGDSFYEYLLKAWVQGNKTEVVTFYREMWDKSMIGLESLIKKSTPSSFVYISERLGNAVYDKMDELACFVPGMLALGSSNSGPGEAEKYISLAEE
  LVWTCYNFYQSTPTKLAGENYYFRNGEDMTVGTSWNIQRPETIESLFYLWRFTGNKTYQEWGWDIFQAFENNSRMETGYVGLKDVTTGTKDNMMQSYFLS
  ETLKYLYLLFSPSSVISLDEWVFNTEAHPLRI
Full Sequence
Protein Sequence     Length: 580     Download
MAKKSSYSSS STSSWRYLQP RYYIKRPKRL ALVLIVCVSL TWILYDRKSL TTGHQDDISK    60
LKEEVTRLQN SLEDIKDHMK DSTESTEKKD EVDKFTKDIS VEDDPISTQR RDKIKDAMLH    120
AWTSYETYAW GRDELKPQSK NGVDNFGGLG ATLVDSLDTL FIMGLDDQFN RAREWVAESL    180
SFDKNIEVSV FETTIRVMGG LLSAYDLSGD NVFLEKARDI ADKLLPAWNT PSGIPYNRIN    240
LASGSTNNPA WARGSSILAD SGSEQLEFIA LSQRTKDPKY QENAEKVIKE LHENFPDDGL    300
LPIYLNPLTG TKTGGSITFG AMGDSFYEYL LKAWVQGNKT EVVTFYREMW DKSMIGLESL    360
IKKSTPSSFV YISERLGNAV YDKMDELACF VPGMLALGSS NSGPGEAEKY ISLAEELVWT    420
CYNFYQSTPT KLAGENYYFR NGEDMTVGTS WNIQRPETIE SLFYLWRFTG NKTYQEWGWD    480
IFQAFENNSR METGYVGLKD VTTGTKDNMM QSYFLSETLK YLYLLFSPSS VISLDEWVFN    540
TEAHPLRIMT RISNEESGDP EEVVPRHLHG RKEGRIEYK*                          600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01532Glyco_hydro_470117548451+
PTZ00470PTZ00470070548494+
Gene Ontology
GO TermDescription
GO:0004571mannosyl-oligosaccharide 1,2-alpha-mannosidase activity
GO:0005509calcium ion binding
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI17906.102855748577unnamed protein product [Vitis vinifera]
EMBLCBI18472.1085754571unnamed protein product [Vitis vinifera]
RefSeqNP_175570.1065514539mannosyl-oligosaccharide 1,2-alpha-mannosidase, putative [Arabidopsis thaliana]
RefSeqXP_002310939.101553513524predicted protein [Populus trichocarpa]
RefSeqXP_002325257.101857815571predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1nxc_A0955581475A Chain A, Structure Of Mouse Golgi Alpha-1,2-Mannosidase Ia Reveals The Molecular Basis For Substrate Specificity Among Class I Enzymes (Family 47 Glycosidases)
PDB1fmi_A01055504458A Chain A, Crystal Structure Of Human Class I Alpha1,2-Mannosidase
PDB1fo3_A01055504458A Chain A, Crystal Structure Of Human Class I Alpha1,2-Mannosidase
PDB1fo2_A01055504458A Chain A, Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin
PDB1x9d_A010555082536A Chain A, Crystal Structure Of Human Class I Alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue
Transmembrane Domains
StartEnd
3045
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO780776507225150
CU6150933212575760
DY9741193061794840
GO8772853081654720
HO780776745055753e-17
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_018_00031.1Aquca_018_00031.2Aquca_018_00031.3Aquca_125_00025.1Aquca_125_00025.2
Aquca_125_00025.3Aquca_125_00025.4Aquca_049_00074.1Aquca_002_00310.1Aquca_125_00025.5
Aquca_002_00310.2
Arabidopsis lyrata479633474272890537494638472957
Arabidopsis thalianaAT3G21160.1AT1G51590.1AT1G51590.2AT1G30000.1AT5G43710.1
AT1G27520.1
Brachypodium distachyonBradi5g20920.1Bradi2g32570.1Bradi2g51467.1Bradi3g59640.1
Brassica rapaBra001816Bra014291Bra018917Bra031256Bra010804
Bra032351Bra032833Bra035984
Carica papayaevm.model.supercontig_95.2evm.model.supercontig_166.13evm.model.supercontig_95.1evm.model.supercontig_67.12evm.model.supercontig_110.19
evm.model.supercontig_58.25
Capsella rubellaCarubv10008737mCarubv10013330mCarubv10008589mCarubv10028673mCarubv10008651m
Chlamydomonas reinhardtiiCre07.g336600.t2.1Cre07.g336600.t1.3Cre06.g301600.t1.3.289.614Cre06.g301600.t1.3.289.614Cre06.g301600.t1.3.61.154
Cre06.g301600.t1.3.61.154
Citrus clementinaCiclev10025230mCiclev10014607mCiclev10019471mCiclev10004553m
Citrus sinensisorange1.1g008341morange1.1g008300morange1.1g008122morange1.1g047597m
Cucumis sativusCucsa.359580.9Cucsa.359580.8Cucsa.359580.1Cucsa.047700.1Cucsa.197180.1
Cucsa.254850.1Cucsa.197180.2
Eucalyptus grandisEucgr.F04021.3Eucgr.F04021.2Eucgr.F04021.1Eucgr.C00102.1Eucgr.D00298.2
Eucgr.D00298.1Eucgr.B00341.1Eucgr.H00217.1Eucgr.D00298.3.295.528Eucgr.D00298.3.295.528
Eucgr.D00298.3.92.294Eucgr.D00298.3.92.294
Fragaria vescamrna30596.1-v1.0-hybridmrna05270.1-v1.0-hybrid.98.305mrna05270.1-v1.0-hybrid.98.305mrna17280.1-v1.0-hybrid.95.302mrna17280.1-v1.0-hybrid.95.302
mrna05270.1-v1.0-hybrid.306.507mrna05270.1-v1.0-hybrid.306.507mrna17280.1-v1.0-hybrid.303.483mrna17280.1-v1.0-hybrid.303.483mrna32588.1-v1.0-hybrid
mrna09481.1-v1.0-hybrid.43.302mrna09481.1-v1.0-hybrid.43.302mrna29049.1-v1.0-hybridmrna09481.1-v1.0-hybrid.302.439mrna09481.1-v1.0-hybrid.302.439
Glycine maxGlyma07g02290.1Glyma08g23730.1Glyma17g06600.2Glyma17g06600.1Glyma13g00470.2
Glyma15g10130.1Glyma13g28910.1Glyma13g28910.2Glyma05g01830.1Glyma10g32320.1
Glyma17g10060.1Glyma17g10060.3Glyma17g10060.2Glyma05g22295.1Glyma20g35290.1
Gossypium raimondiiGorai.005G122200.2Gorai.005G122200.1Gorai.011G003500.6Gorai.011G003500.2Gorai.011G003500.1
Gorai.011G003500.3Gorai.011G003500.4Gorai.011G003500.5Gorai.010G238600.1Gorai.009G155100.5
Gorai.009G155100.2Gorai.009G155100.1Gorai.009G155100.4Gorai.009G155100.3Gorai.006G187900.2
Gorai.006G187900.1Gorai.006G245800.2Gorai.006G245800.1Gorai.006G187900.3Gorai.006G187900.4
Linum usitatissimumLus10034820Lus10035727Lus10037312Lus10042830Lus10033368.153.381
Lus10033368.153.381Lus10028127Lus10042143Lus10033368.428.563Lus10033368.428.563
Lus10041170Lus10021888.49.301Lus10021888.49.301Lus10004233Lus10021888.303.456
Lus10021888.303.456
Malus domesticaMDP0000857857MDP0000308427MDP0000143766MDP0000156362.354.619MDP0000156362.354.619
MDP0000167309MDP0000316328MDP0000156362.225.356MDP0000156362.225.356MDP0000268730.351.588
MDP0000268730.351.588MDP0000268730.596.800MDP0000268730.596.800MDP0000230215MDP0000208346
MDP0000245188.48.176MDP0000245188.48.176MDP0000319401.48.275MDP0000319401.48.275MDP0000319401.311.449
MDP0000319401.311.449MDP0000245188.210.319MDP0000245188.210.319MDP0000222952
Manihot esculentacassava4.1_026203mcassava4.1_003593mcassava4.1_003599mcassava4.1_011906mcassava4.1_015511m
cassava4.1_003747mcassava4.1_004429m
Medicago truncatulaMedtr4g127310.1Medtr2g019520.2Medtr2g019520.1Medtr2g019520.3Medtr4g106370.1
Medtr1g093270.1
Mimulus guttatusmgv1a003772mmgv1a002872mmgv1a025048mmgv1a002884m
Oryza sativaLOC_Os04g51690.1LOC_Os05g11850.1LOC_Os01g56670.1LOC_Os01g56670.3LOC_Os01g56670.2
LOC_Os02g50780.1LOC_Os01g56670.4
Panicum virgatumPavirv00024177mPavirv00056286mPavirv00057415mPavirv00052269mPavirv00016853m
Pavirv00054954mPavirv00016455mPavirv00000605mPavirv00017739m
Physcomitrella patensPp1s387_34V6.1Pp1s16_48V6.1Pp1s58_280V6.1Pp1s313_34V6.1
Phaseolus vulgarisPhvul.008G254800.1Phvul.006G164400.1Phvul.003G197300.1Phvul.007G109800.1Phvul.006G033000.1
Phvul.011G127200.1
Picea abiesMA_10430881g0010MA_10426596g0010MA_311901g0010MA_10180832g0010MA_170877g0010
MA_8281735g0010MA_118584g0010
Populus trichocarpaPotri.018G141100.2Potri.018G141100.1Potri.008G007500.1Potri.008G007500.2Potri.018G141100.3
Potri.018G141100.4Potri.004G132300.1Potri.004G132300.2Potri.004G132300.4Potri.004G132300.3
Potri.015G071400.1Potri.012G076600.1Potri.008G160900.1Potri.015G071400.2Potri.012G076600.2
Prunus persicappa004310mppa026880mppa002795mppa003534mppa002909m
ppa012357m
Ricinus communis28359.m00028030063.m00145129693.m00202130147.m01400429844.m003177
Setaria italicaSi013487mSi009718mSi021445mSi016751mSi004250m
Selaginella moellendorffii1013518511116848592622229806
228194
Sorghum bicolorSb06g027810.1Sb09g006500.1Sb03g036080.1Sb04g028330.1
Thellungiella halophilaThhalv10011358mThhalv10020383mThhalv10007084mThhalv10003168mThhalv10007201m
Vitis viniferaGSVIVT01029601001GSVIVT01029306001GSVIVT01029623001GSVIVT01021446001GSVIVT01007818001
GSVIVT01018097001GSVIVT01029609001
Volvox carteriVocar20012263m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)