y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.003G150000.4
FamilyGH33
Protein PropertiesLength: 252 Molecular Weight: 28272.6 Isoelectric Point: 9.8998
ChromosomeChromosome/Scaffold: 03 Start: 35207019 End: 35210465
DescriptionBNR/Asp-box repeat family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH33362416.6e-26
  RWSGFVKRSYDKGMTWTAREQLPPGILGPIKNKPILLENGNLICGSSVESWNSWGAWVEVTEDLGRSWSKHGPIYIENKPLSVIQPVPYQTANGKLRVLL
  RSFDGIGRVCMSESSDGGKTWGYAKPTQLPNPNSGIDGVKLRDGRLLLAYNTKSRGVLKVALSKDDGDSWCEFLTLEDTRGMEFSYPAVIQDSDGRIHIT
  YTYDRT
Full Sequence
Protein Sequence     Length: 252     Download
MLLPLLRLIR IIFWLPILGV HSRGHLMSKY GCRLTRWSGF VKRSYDKGMT WTAREQLPPG    60
ILGPIKNKPI LLENGNLICG SSVESWNSWG AWVEVTEDLG RSWSKHGPIY IENKPLSVIQ    120
PVPYQTANGK LRVLLRSFDG IGRVCMSESS DGGKTWGYAK PTQLPNPNSG IDGVKLRDGR    180
LLLAYNTKSR GVLKVALSKD DGDSWCEFLT LEDTRGMEFS YPAVIQDSDG RIHITYTYDR    240
TQIKHVVLRP S*                                                        300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4692COG46926.0e-1664250235+
pfam13088BNR_22.0e-7125234220+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU18568.1026251129354unknown [Glycine max]
RefSeqNP_851204.102624999322BNR/Asp-box repeat family protein [Arabidopsis thaliana]
RefSeqXP_002263578.103249119367PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002324495.10925177321predicted protein [Populus trichocarpa]
RefSeqXP_002531744.101025178321conserved hypothetical protein [Ricinus communis]
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FF546615224292520
FE897759191262160
CV274814225262500
FF595131216362510
CJ960179218342510
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_027_00263.5Aquca_027_00263.1Aquca_027_00263.2Aquca_027_00263.3Aquca_027_00263.4
Arabidopsis lyrata495867
Arabidopsis thalianaAT5G57700.1AT5G57700.2AT5G57700.3AT5G57700.4
Brachypodium distachyonBradi1g26287.2Bradi1g26287.4Bradi1g26287.1Bradi1g26287.3
Brassica rapaBra006806
Capsella rubellaCarubv10028058m
Citrus clementinaCiclev10008429m
Citrus sinensisorange1.1g020796m
Cucumis sativusCucsa.063760.7Cucsa.063760.5Cucsa.063760.1
Eucalyptus grandisEucgr.C02440.3Eucgr.C02440.2Eucgr.C02440.1
Fragaria vescamrna29636.1-v1.0-hybrid
Glycine maxGlyma13g01390.2Glyma13g01380.1Glyma17g07500.2Glyma17g07500.3Glyma17g07500.1
Gossypium raimondiiGorai.010G053100.8Gorai.010G053100.9Gorai.010G053100.6Gorai.012G095700.1Gorai.010G053100.5
Gorai.010G053100.4Gorai.010G053100.3Gorai.010G053100.2Gorai.010G053100.10Gorai.010G053100.1
Linum usitatissimumLus10008903
Malus domesticaMDP0000155009
Manihot esculentacassava4.1_011952m
Medicago truncatulaMedtr4g129200.1Medtr4g129180.1
Mimulus guttatusmgv1a018339m
Oryza sativaLOC_Os07g33220.1LOC_Os07g33224.1
Panicum virgatumPavirv00000088mPavirv00019697mPavirv00063023mPavirv00001202mPavirv00001203m
Pavirv00068158mPavirv00059537m
Physcomitrella patensPp1s96_140V6.2
Phaseolus vulgarisPhvul.003G150200.1Phvul.003G150000.2Phvul.003G150000.1Phvul.003G150000.5Phvul.003G150000.3
Phvul.003G150000.6
Picea abiesMA_10435121g0010
Populus trichocarpaPotri.018G097100.1
Prunus persicappa020159m
Ricinus communis29749.m000140
Setaria italicaSi030500mSi030939mSi030026mSi029094m
Selaginella moellendorffii84263
Sorghum bicolorSb02g034675.1Sb02g034680.1
Thellungiella halophilaThhalv10013983m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny