y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.003G151000.1
FamilyGT22
Protein PropertiesLength: 537 Molecular Weight: 61993.4 Isoelectric Point: 9.5499
ChromosomeChromosome/Scaffold: 03 Start: 35426536 End: 35430802
DescriptionAlg9-like mannosyltransferase family
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT22384430
  IFLLCLAFRMVNSVLVQTYFNPDEHWQGPEIAHRVAFGYGHLTWEWKQGIRSYLHPMFFVPLYRLLALLHLDNPWVMMRAPRLLQSVFSAVGDLYLYKLS
  KILFGDSVAKWTLFSQLSNWFMFYCFSRTLSNSLETVLTLVSLYFWPCMRSSSNYSFVSRKWGLAVAAVACAIRPTSAITWLYVGLLELLKSHDRFKFIF
  LEVAPIGILVLGLTCLLDRFMYGTWVLVPLNFLKFNFLSSGGDYYGTHKWHWYFTQGFTVMILSYLPFCIAGIIYSKQWKFSGLLAWVLGFYSLLGHKEF
  RFVLPVLPIALMFSGYSLAAIEDPRSARYKGKESSKTHTRCSPKMGIAILFLLATNIPMALYMSLIHQRGPEDVMNHLAREVRHGKVNSILFLTPCHATP
  YYSMLH
Full Sequence
Protein Sequence     Length: 537     Download
MRRRHSSNND ADKQKSKAPT SSKLDSEHSS FCCSHKRIFL LCLAFRMVNS VLVQTYFNPD    60
EHWQGPEIAH RVAFGYGHLT WEWKQGIRSY LHPMFFVPLY RLLALLHLDN PWVMMRAPRL    120
LQSVFSAVGD LYLYKLSKIL FGDSVAKWTL FSQLSNWFMF YCFSRTLSNS LETVLTLVSL    180
YFWPCMRSSS NYSFVSRKWG LAVAAVACAI RPTSAITWLY VGLLELLKSH DRFKFIFLEV    240
APIGILVLGL TCLLDRFMYG TWVLVPLNFL KFNFLSSGGD YYGTHKWHWY FTQGFTVMIL    300
SYLPFCIAGI IYSKQWKFSG LLAWVLGFYS LLGHKEFRFV LPVLPIALMF SGYSLAAIED    360
PRSARYKGKE SSKTHTRCSP KMGIAILFLL ATNIPMALYM SLIHQRGPED VMNHLAREVR    420
HGKVNSILFL TPCHATPYYS MLHHNLPMQF LDCTPSEEKG VPDESDRFLM DPVSFVSEYA    480
KNVSMASHIV LFDSEEQKLK NLLISFNYGE EKRFFNAHFK VDRDLQASVV VYVRRR*       540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03901Glyco_transf_226.0e-11337443427+
PLN02816PLN0281601533540+
Gene Ontology
GO TermDescription
GO:0006506GPI anchor biosynthetic process
GO:0016757transferase activity, transferring glycosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN70801.10405321494hypothetical protein [Vitis vinifera]
EMBLCBI36602.10253398622unnamed protein product [Vitis vinifera]
RefSeqNP_568305.1015331542mannosyltransferase, putative [Arabidopsis thaliana]
RefSeqXP_002271446.1015331537PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002513232.1015331534glycosyltransferase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
167186
201223
235257
289311
318334
339358
382404
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7914053001814800
CO9796582382885250
HO413864517495300
GO8453593531564950
FD4934112312534830
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00400.3Aquca_016_00400.1Aquca_016_00400.2
Arabidopsis lyrata861876
Arabidopsis thalianaAT5G14850.1AT5G14850.2
Brachypodium distachyonBradi3g01150.1
Brassica rapaBra023489
Carica papayaevm.model.supercontig_42.125
Capsella rubellaCarubv10000649m
Citrus clementinaCiclev10007971m
Citrus sinensisorange1.1g009445morange1.1g010488m
Cucumis sativusCucsa.351020.4Cucsa.351020.2Cucsa.351020.1Cucsa.351020.3
Eucalyptus grandisEucgr.C00228.1
Fragaria vescamrna04987.1-v1.0-hybrid
Glycine maxGlyma13g01500.1Glyma17g07620.2
Gossypium raimondiiGorai.010G092100.8Gorai.010G092100.1Gorai.010G092100.7Gorai.010G092100.6Gorai.010G092100.4
Gorai.010G092100.3Gorai.010G092100.2Gorai.010G092100.5
Linum usitatissimumLus10033341Lus10033296Lus10034759
Manihot esculentacassava4.1_005070m
Medicago truncatulaMedtr4g129500.1
Mimulus guttatusmgv1a004248m
Oryza sativaLOC_Os01g39810.4LOC_Os01g39810.3LOC_Os01g39810.2LOC_Os01g39810.1LOC_Os02g02110.1
Panicum virgatumPavirv00059707mPavirv00064501m
Physcomitrella patensPp1s32_143V6.1
Picea abiesMA_10430738g0010
Populus trichocarpaPotri.018G098700.3Potri.018G098700.1Potri.018G098700.2
Prunus persicappa003843m
Ricinus communis30225.m001678
Setaria italicaSi016829m
Selaginella moellendorffii105923
Sorghum bicolorSb09g025250.1
Thellungiella halophilaThhalv10013155m
Vitis viniferaGSVIVT01023723001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny