y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.003G170100.1
FamilyGT4
Protein PropertiesLength: 1056 Molecular Weight: 117544 Isoelectric Point: 6.3241
ChromosomeChromosome/Scaffold: 03 Start: 38063134 End: 38070587
Descriptionsucrose phosphate synthase 1F
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT44706380
  TNPRKPMILALARPDPKKNITTLVKAFGECRPLQELANLTLIMGNRDGIDEMSSTNASVLLSVLKLIDKYDLYGQVAYPKHHKQSDVPDIYRLAAKTKGV
  FINPAFIEPFGLTLIEAAAHGLPTVATKNGGPVDIVRVLDNGLLIDPHDEQSIADALLKLVSNKQLWAK
Full Sequence
Protein Sequence     Length: 1056     Download
MAGNDWLNSY LEAILDVGPG LDDSKSSLLL RERGRFSPTR YFVEEVIGFD ETDLYRSWVR    60
ASSTRSPQER NTRLENMCWR IWNLARQKKQ LESETAQRLN KRRLERERGR REATADMSED    120
LSEGEKGDPV SDTSAHGDTY RARMPRISSA DAMESWANSQ KGKKLYIVLV SIHGLIRGEN    180
MELGRDSDTG GQVKYVVELA RALGSMPGVY RVDLLTRQVS APDVDWSYGE PTEMLTPRDS    240
DDFGDDMGES SGSYIVRIPF GPRDKYIPKE LLWPHIPEFV DGALNHIIQM SKSLGEQIGS    300
GHAIWPVAIH GHYADAGDSA ALLSGALNVP MLFTGHSLGR DKLEQLLKQG RLSRDEINAT    360
YKIMRRIEAE ELALDGSEIV ITSTRQEIEE QWRLYDGFDP VLERKIRARI RRNVSCYGRS    420
MPRMATIPPG MEFHHIVPQD GDIEGEPEGN LDHPAPQDPP IWSEIMRFFT NPRKPMILAL    480
ARPDPKKNIT TLVKAFGECR PLQELANLTL IMGNRDGIDE MSSTNASVLL SVLKLIDKYD    540
LYGQVAYPKH HKQSDVPDIY RLAAKTKGVF INPAFIEPFG LTLIEAAAHG LPTVATKNGG    600
PVDIVRVLDN GLLIDPHDEQ SIADALLKLV SNKQLWAKCR QNGLKNIHLF SWPEHCKTYL    660
SKIATCKPRH PQWQRIEDGG ESSESESPGD SLRDIQDLSL NMKFSLDGEK SGGSGNDNSL    720
DSDGNGADRK AKLENALLSW SKGISKDTRR GGATEKSDQN PNAGKFPPLR RRKHLFVIAV    780
DCDTTSGLLE TIKVIFESAG KDRAEGSIGF ILSTSLTISE IQSFLISGGL SPSDFDAYIC    840
NSGSDLYYPS LNPEDRPFVV DLYYHSHIEY RWGGEGLRKT LLRWADSITD KGGNNEQIVS    900
PAEQLSTDYC YAFKVRKPGM APPVKELRKL LRIQALRCHP IYCQNGTRLN VIPVLASRSQ    960
ALRYLYVRWG FELSKIVVFA GECGDTDYEG LLGGLHKSVI LKGVGSSAIS QLHNNRNYPL    1020
SDVMPLDSPN IVEATEGSSG TDIQALIEKV GYLSG*                              1080
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd03801GT1_YqgM_like6.0e-31190660475+
TIGR02470sucr_synth1.0e-41167661535+
cd03800GT1_Sucrose_synthase2.0e-143166661497+
TIGR02472sucr_P_syn_N4.0e-168165663503+
TIGR02468sucrsPsyn_pln0110511059+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK09427.201105511058AF322116_1 sucrose-phosphate synthase [Medicago sativa]
GenBankABV32551.101105311055sucrose phosphate synthase protein 1 [Prunus persica]
Swiss-ProtO2206001105311055SPS1_CITUN RecName: Full=Sucrose-phosphate synthase 1; AltName: Full=UDP-glucose-fructose-phosphate glucosyltransferase 1
Swiss-ProtQ4387601105511059SPS_VICFA RecName: Full=Sucrose-phosphate synthase; AltName: Full=UDP-glucose-fructose-phosphate glucosyltransferase
RefSeqXP_002265473.101105511052PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2r68_A018866931462A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB2r66_A018866931462A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB2r60_A018866931462A Chain A, Structure Of Apo Sucrose Phosphate Synthase (Sps) Of Halothermothrix Orenii
PDB3s29_H5e-33167678281777A Chain A, Structure Of Apo Sucrose Phosphate Synthase (Sps) Of Halothermothrix Orenii
PDB3s29_G5e-33167678281777A Chain A, Structure Of Apo Sucrose Phosphate Synthase (Sps) Of Halothermothrix Orenii
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO78046843214320
HO80163732173710560
HO7965784271595790
HO796578855576411e-39
HO796578256506741e-39
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00099.3Aquca_034_00099.2Aquca_034_00099.1Aquca_011_00228.1Aquca_114_00017.1
Aquca_020_00040.3Aquca_020_00040.2Aquca_020_00040.1Aquca_002_01365.2Aquca_002_01365.1
Aquca_020_00566.4Aquca_020_00566.3Aquca_020_00566.2Aquca_020_00566.1Aquca_003_00666.4
Aquca_003_00666.2Aquca_003_00666.1Aquca_003_00666.3
Arabidopsis lyrata470477487943489859488935494980
316284484788910122493691
Arabidopsis thalianaAT1G04920.1AT5G11110.1AT4G10120.2AT4G10120.1AT5G20280.1
AT5G49190.1AT1G73370.2AT1G73370.1AT3G43190.1AT5G20830.2
AT5G20830.1AT5G37180.1AT4G02280.1
Brachypodium distachyonBradi2g58860.1Bradi3g20120.1Bradi4g21750.1Bradi3g06217.1Bradi1g30520.1
Bradi1g29570.1Bradi3g60687.1Bradi1g46670.3Bradi1g46670.1Bradi1g62957.1
Bradi1g60320.3Bradi1g60320.2Bradi1g60320.1Bradi1g20890.1
Brassica rapaBra015364Bra033195Bra009830Bra006090Bra002289
Bra020096Bra037432Bra003845Bra006578Bra002332
Bra015995Bra039502Bra036282
Carica papayaevm.model.supercontig_46.57evm.model.supercontig_142.9evm.model.supercontig_83.22evm.model.supercontig_217.19evm.model.supercontig_82.65
evm.model.supercontig_178.35evm.model.supercontig_50.160evm.TU.contig_29609.1
Capsella rubellaCarubv10008160mCarubv10000113mCarubv10000112mCarubv10025867mCarubv10019738m
Carubv10000208mCarubv10016702mCarubv10006192mCarubv10000249m
Chlamydomonas reinhardtiiCre12.g524000.t1.2
Citrus clementinaCiclev10004221mCiclev10007311mCiclev10018655mCiclev10007312mCiclev10004341m
Ciclev10007488mCiclev10007487mCiclev10007486mCiclev10007485mCiclev10007484m
Ciclev10007483mCiclev10007482mCiclev10007481mCiclev10007480mCiclev10010343m
Ciclev10011062mCiclev10018889mCiclev10019255mCiclev10024638m
Citrus sinensisorange1.1g001492morange1.1g002660morange1.1g001541morange1.1g001705morange1.1g002665m
orange1.1g001557morange1.1g003726morange1.1g003962morange1.1g003661morange1.1g003657m
orange1.1g003656morange1.1g003655morange1.1g003652morange1.1g003647morange1.1g003646m
orange1.1g003947morange1.1g002909morange1.1g036539morange1.1g006524morange1.1g005444m
orange1.1g003987morange1.1g003985morange1.1g003636morange1.1g003552morange1.1g003549m
orange1.1g003492morange1.1g005365m
Cucumis sativusCucsa.266070.1Cucsa.249370.2Cucsa.249370.1Cucsa.088480.1Cucsa.173660.1
Cucsa.112470.1Cucsa.142060.2Cucsa.142060.1Cucsa.096950.1
Eucalyptus grandisEucgr.H00041.1Eucgr.F02931.1Eucgr.C01715.1Eucgr.E03524.1Eucgr.E03528.1
Eucgr.C03205.1Eucgr.C03199.1Eucgr.C03201.1Eucgr.C03204.1Eucgr.K03505.1
Eucgr.J01640.3Eucgr.J01640.2Eucgr.J01640.1Eucgr.K02305.2Eucgr.K02305.1
Eucgr.H01094.2Eucgr.H01094.1Eucgr.C00769.1Eucgr.C03207.1Eucgr.F01010.1
Eucgr.H03515.1Eucgr.B01577.1Eucgr.H03496.1
Fragaria vescamrna06523.1-v1.0-hybridmrna31122.1-v1.0-hybridmrna31164.1-v1.0-hybridmrna11606.1-v1.0-hybridmrna07050.1-v1.0-hybrid
mrna12940.1-v1.0-hybridmrna11429.1-v1.0-hybridmrna31666.1-v1.0-hybridmrna11077.1-v1.0-hybridmrna09290.1-v1.0-hybrid
Glycine maxGlyma14g03300.1Glyma06g48200.1Glyma08g42140.1Glyma18g12890.1Glyma17g11820.1
Glyma13g23060.2Glyma13g23060.1Glyma04g12220.2Glyma15g16171.2Glyma15g16171.1
Glyma11g33240.1Glyma17g05067.2Glyma17g05067.1Glyma15g20180.3Glyma15g20180.2
Glyma15g20180.1Glyma13g17421.4Glyma13g17421.3Glyma13g17421.1Glyma09g08550.6
Glyma09g08550.5Glyma09g08550.4Glyma09g08550.1Glyma14g39070.1Glyma02g40740.1
Glyma19g40041.2Glyma19g40041.1Glyma03g37441.2Glyma03g37441.1Glyma16g34290.2
Glyma16g34290.1Glyma09g29710.1
Gossypium raimondiiGorai.011G155900.4Gorai.011G155900.3Gorai.011G155900.2Gorai.011G155900.1Gorai.009G262100.2
Gorai.009G262100.1Gorai.010G116100.2Gorai.010G116100.1Gorai.013G235900.1Gorai.004G292800.2
Gorai.004G292800.1Gorai.009G038000.7Gorai.009G038000.6Gorai.009G038000.4Gorai.009G038000.3
Gorai.009G038000.2Gorai.009G038000.1Gorai.013G222400.2Gorai.013G222400.1Gorai.001G017700.1
Gorai.007G047100.1Gorai.010G092300.5Gorai.010G092300.4Gorai.010G092300.3Gorai.010G092300.2
Gorai.010G092300.1Gorai.010G091800.2Gorai.010G091800.1Gorai.001G083400.4Gorai.001G083400.3
Gorai.001G083400.2Gorai.001G083400.1Gorai.004G142700.3Gorai.004G142700.2Gorai.004G142700.1
Linum usitatissimumLus10016657Lus10038119Lus10008056Lus10041041Lus10022570
Lus10006184Lus10020506Lus10012454Lus10017984Lus10007372
Lus10020791Lus10001468Lus10041979Lus10013417Lus10010308
Lus10008206
Malus domesticaMDP0000288684MDP0000783676MDP0000256965MDP0000137330MDP0000306580
MDP0000288876MDP0000174537MDP0000293214MDP0000581406MDP0000161129
MDP0000250070MDP0000215889MDP0000277711MDP0000287311MDP0000872262
MDP0000415558MDP0000132527MDP0000293649MDP0000160578MDP0000204871
MDP0000126946MDP0000204870MDP0000212593MDP0000188551MDP0000138004
MDP0000252802
Manihot esculentacassava4.1_000839mcassava4.1_000827mcassava4.1_024105mcassava4.1_001415mcassava4.1_000867m
cassava4.1_000744mcassava4.1_001062mcassava4.1_000732mcassava4.1_002265mcassava4.1_001912m
cassava4.1_001871mcassava4.1_001867mcassava4.1_001864mcassava4.1_001874mcassava4.1_001283m
cassava4.1_027790mcassava4.1_002238mcassava4.1_001840mcassava4.1_026466m
Medicago truncatulaMedtr5g091340.1Medtr3g047380.1Medtr4g115620.1Medtr4g124660.4Medtr4g124660.3
Medtr4g124660.2Medtr4g124660.1Medtr3g064610.1Medtr5g076830.1Medtr1g088170.1
Medtr6g081120.1Medtr6g081200.1Medtr6g081180.1
Mimulus guttatusmgv1a000579mmgv1a000604mmgv1a000596mmgv1a000621mmgv1a001291m
mgv1a024320mmgv1a002736mmgv1a001481mmgv1a001207m
Oryza sativaLOC_Os01g69030.4LOC_Os01g69030.3LOC_Os01g69030.2LOC_Os01g69030.1LOC_Os11g12810.1
LOC_Os08g20660.2LOC_Os08g20660.1LOC_Os02g09170.2LOC_Os02g09170.1LOC_Os06g43630.1
LOC_Os02g58480.1LOC_Os04g24430.1LOC_Os04g17650.1LOC_Os06g09450.8LOC_Os06g09450.7
LOC_Os06g09450.6LOC_Os06g09450.5LOC_Os06g09450.4LOC_Os06g09450.3LOC_Os06g09450.2
LOC_Os06g09450.1LOC_Os03g22120.3LOC_Os03g22120.1LOC_Os03g28330.4LOC_Os03g28330.3
LOC_Os03g28330.2LOC_Os03g28330.1LOC_Os07g42490.2LOC_Os07g42490.1
Panicum virgatumPavirv00017689mPavirv00015422mPavirv00021568mPavirv00021567mPavirv00021566m
Pavirv00040314mPavirv00068375mPavirv00009592mPavirv00069185mPavirv00025176m
Pavirv00065876mPavirv00061751mPavirv00054750mPavirv00054749mPavirv00031455m
Pavirv00032661mPavirv00046633mPavirv00046632mPavirv00046631mPavirv00047139m
Pavirv00026880mPavirv00026879mPavirv00022656m
Physcomitrella patensPp1s66_227V6.1Pp1s131_107V6.1Pp1s120_66V6.1Pp1s28_394V6.2Pp1s28_394V6.1
Pp1s93_98V6.1Pp1s303_45V6.1
Phaseolus vulgarisPhvul.006G031700.1Phvul.005G002600.1Phvul.009G250800.1Phvul.006G087300.1Phvul.003G127500.1
Phvul.009G223800.2Phvul.009G223800.1Phvul.008G241300.1Phvul.001G209600.2Phvul.001G209600.1
Phvul.004G142800.1
Picea abiesMA_10743g0010MA_103595g0010MA_10432412g0010MA_10427170g0010MA_10430807g0030
MA_319g0010MA_10432094g0010MA_113423g0010MA_27253g0010MA_10429251g0010
MA_127762g0010
Populus trichocarpaPotri.013G095500.2Potri.013G095500.1Potri.017G057800.1Potri.001G317600.1Potri.018G124700.4
Potri.018G124700.3Potri.018G124700.1Potri.018G124700.2Potri.018G025100.2Potri.018G025100.1
Potri.001G317600.2Potri.006G064300.2Potri.006G064300.1Potri.006G136700.2Potri.006G136700.1
Potri.015G029100.3Potri.015G029100.2Potri.015G029100.1Potri.018G063500.2Potri.018G063500.1
Potri.012G037200.2Potri.012G037200.1Potri.004G081300.2Potri.004G081300.1Potri.017G139100.3
Potri.017G139100.2Potri.017G139100.1Potri.002G202300.1Potri.014G126800.1
Prunus persicappa000622mppa000639mppa000636mppa000716mppa001573m
ppa001537mppa001535mppa017606mppa001845mppa001135m
ppa002723m
Ricinus communis28543.m00038429904.m00290330074.m00133629848.m00459929739.m003693
29660.m00076129951.m00014329726.m00408629986.m001646
Setaria italicaSi000130mSi025907mSi013170mSi013169mSi016229m
Si005825mSi005783mSi005845mSi020148mSi034293m
Si005882mSi005881mSi005880mSi005859mSi034282m
Si034281mSi034280mSi034279m
Selaginella moellendorffii1484192020591988268237
Sorghum bicolorSb03g043900.1Sb05g007310.1Sb09g028570.1Sb04g005720.1Sb10g025240.1
Sb10g031040.2Sb10g031040.1Sb01g035890.1Sb10g006330.3Sb10g006330.2
Sb10g006330.1Sb01g033060.1Sb04g038410.1
Thellungiella halophilaThhalv10006639mThhalv10028384mThhalv10012643mThhalv10012540mThhalv10012539m
Thhalv10003667mThhalv10018094mThhalv10012719mThhalv10027639mThhalv10028457m
Thhalv10028435m
Vitis viniferaGSVIVT01020928001GSVIVT01037186001GSVIVT01012825001GSVIVT01035882001GSVIVT01034794001
GSVIVT01035106001GSVIVT01029388001GSVIVT01015018001GSVIVT01035210001GSVIVT01028043001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)