y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.003G234900.1
FamilyGH43
Protein PropertiesLength: 470 Molecular Weight: 54010.4 Isoelectric Point: 9.164
ChromosomeChromosome/Scaffold: 03 Start: 45708152 End: 45713797
DescriptionArabinanase/levansucrase/invertase
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH431563851.1e-33
  ILYDERSNTYYWYGEYKDGLTYRAHKRGAARVDIIGVGCYSSKDLWTWKNEGIVLAAEEMNGTHDLYKSNVLERPKVIFNEKTRKYVMWMHIDDANYTKA
  AVGIAISDTPDGPFEYVGSQRPHGYESRDMTVFKDEDGVAYLIYSSEENNVLHIGPMTEDYLNLMPVMRRVFVGQRREAPAVFKHQGTYYMITSGCTGWA
  PNEALAHAAESILGPWETMGNPCVGGNKMF
Full Sequence
Protein Sequence     Length: 470     Download
MRMRNLYRKP TTLRCNAGSR CYSASAVIWS LLGCLLLFHL YSNIHHKHGE GREVQLRVTN    60
HPQFRELQQV EEEIIQLPPP KGKRSPRAAK RRHKRVTPLV DEFLDEDSRL RHVFFPGNKS    120
AIDPVKVTGN DSYYYYPGRI WLDTDRNPIQ AHGGGILYDE RSNTYYWYGE YKDGLTYRAH    180
KRGAARVDII GVGCYSSKDL WTWKNEGIVL AAEEMNGTHD LYKSNVLERP KVIFNEKTRK    240
YVMWMHIDDA NYTKAAVGIA ISDTPDGPFE YVGSQRPHGY ESRDMTVFKD EDGVAYLIYS    300
SEENNVLHIG PMTEDYLNLM PVMRRVFVGQ RREAPAVFKH QGTYYMITSG CTGWAPNEAL    360
AHAAESILGP WETMGNPCVG GNKMFRIATF LAQSTFVLPL PGFSGSFIFM ADRWNPSDLR    420
NSRYVWLPLI VEGPTDQAPQ YSSTLPLWSR VSIYWHRKWR LPQGWSTFK*               480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd08999GH43_ABN_28.0e-16194377203+
cd09004GH43_bXyl2.0e-18193376197+
cd08990GH43_AXH_like8.0e-19194375196+
cd08978GH_F7.0e-45152429289+
cd08985GH43_62.0e-130149429282+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU19498.101346910465unknown [Glycine max]
EMBLCBI33680.1014651430unnamed protein product [Vitis vinifera]
RefSeqNP_201555.204246246466glycosyl hydrolase family protein 43 [Arabidopsis thaliana]
RefSeqNP_975008.104246251471glycosyl hydrolase family protein 43 [Arabidopsis thaliana]
RefSeqXP_002525277.10146932499beta-glucanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3vt2_F013844445344A Chain A, High Resolution X-Ray Structure Of Human Galectin-3 In Complex With Lacnac
PDB3vt2_E013844445344A Chain A, High Resolution X-Ray Structure Of Human Galectin-3 In Complex With Lacnac
PDB3vt2_D013844445344A Chain A, High Resolution X-Ray Structure Of Human Galectin-3 In Complex With Lacnac
PDB3vt2_C013844445344A Chain A, High Resolution X-Ray Structure Of Human Galectin-3 In Complex With Lacnac
PDB3vt2_B013844445344A Chain A, High Resolution X-Ray Structure Of Human Galectin-3 In Complex With Lacnac
Transmembrane Domains
StartEnd
2143
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8561533341324650
GO3743623541244700
GT7395993021334340
GO8017532981694660
EY7037302901484370
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_060_00007.3Aquca_060_00007.1Aquca_060_00007.2
Arabidopsis lyrata906305332819
Arabidopsis thalianaAT5G67540.2AT5G67540.1AT3G49880.1
Brachypodium distachyonBradi2g50980.2Bradi1g71160.1Bradi2g50980.1
Brassica rapaBra024441Bra029980Bra036036
Capsella rubellaCarubv10027885mCarubv10019437m
Citrus clementinaCiclev10025553mCiclev10025552mCiclev10025561m
Citrus sinensisorange1.1g011114morange1.1g012300morange1.1g012453m
Cucumis sativusCucsa.366970.1Cucsa.366990.1
Eucalyptus grandisEucgr.I00703.2Eucgr.I00703.1Eucgr.H02307.1
Fragaria vescamrna05759.1-v1.0-hybrid
Glycine maxGlyma05g22470.3Glyma17g17390.3Glyma17g17390.2Glyma17g17390.1Glyma05g22470.6
Glyma05g22470.5Glyma05g22470.4Glyma05g22470.2Glyma01g40190.1Glyma11g05100.1
Gossypium raimondiiGorai.011G214500.1Gorai.008G083400.1Gorai.003G030500.1Gorai.003G030500.2
Linum usitatissimumLus10011543Lus10019280
Malus domesticaMDP0000248963MDP0000503275MDP0000406084
Manihot esculentacassava4.1_032973mcassava4.1_007150mcassava4.1_007066m
Medicago truncatulaMedtr5g015460.1Medtr4g097110.1
Mimulus guttatusmgv1a018781mmgv1a005746m
Oryza sativaLOC_Os12g21789.1LOC_Os12g21789.2LOC_Os01g65720.1
Panicum virgatumPavirv00010178mPavirv00067870mPavirv00058950mPavirv00044467m
Physcomitrella patensPp1s410_9V6.1Pp1s16_243V6.1
Phaseolus vulgarisPhvul.002G010600.1
Picea abiesMA_181765g0010
Populus trichocarpaPotri.005G148800.1Potri.005G148800.2
Prunus persicappa005306m
Ricinus communis48021.m00001434138.m00001529661.m000924
Setaria italicaSi001388mSi035531m
Selaginella moellendorffii44066110234
Sorghum bicolorSb03g041630.1Sb01g043810.1
Thellungiella halophilaThhalv10004148mThhalv10010347m
Vitis viniferaGSVIVT01000105001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny