y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.003G239400.1
FamilyCBM57
Protein PropertiesLength: 734 Molecular Weight: 81940.9 Isoelectric Point: 6.6109
ChromosomeChromosome/Scaffold: 03 Start: 46227069 End: 46229770
DescriptionProtein kinase superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM57541958.1e-21
  YFINCGSDNSVTESGKVYVAESNHDASFNSSNTERNQSSVPSPLYQTARIFRRVSWYKFNIDSNGTYLLRLHFFPFSSPSNLSSARFNVSVPGFWLLQNF
  DGTNDTNNNSALVKEFFMEISAPTFKITFRPLESSFAFVNAI
Full Sequence
Protein Sequence     Length: 734     Download
MQISHPKLSP DHHLSMDIPK LHIIQHSRCI ALLFLLQFSS LHFPSLGYNV PDKYFINCGS    60
DNSVTESGKV YVAESNHDAS FNSSNTERNQ SSVPSPLYQT ARIFRRVSWY KFNIDSNGTY    120
LLRLHFFPFS SPSNLSSARF NVSVPGFWLL QNFDGTNDTN NNSALVKEFF MEISAPTFKI    180
TFRPLESSFA FVNAIELFVL PLHLISDKVS FFKPIGGTSI YSGGLYSRVL ETKHRLNVGG    240
QPTKDLLLRN WIPDDIYLMY TENAKNRSPY NGEIGYHVDD DSDVIESSND VPRDMDEPDS    300
NHHPFPVVLG SVLGGLALAF VVVLLGFLLR FKMRKEKPVG NSDWLSVLVN AGGSSHSRLT    360
DISSHGSALP NINLGLKIPL IDLQLATKNF HESQLIGEGG FGNVYKGVLK NGMTVAVKRS    420
QPGSGQGLPE FQTEIMVLSK IRHRHLVSLI GYCDERLEMI LVYEYMEKGT LRDHLYNTKF    480
PTLSWKARLQ ICIDSARGLH YLHKGAAGGI IHRDVKSTNI LLDENHVAKV ADFGLSRSGP    540
LGTESYVTTG VKGTFGYLDL EYFRSQHLTE KSDVYSFGVV LLEVLCARAA IDPSLPRDQI    600
NLAEWGLLCK NKGTLQEIID PSIKDQIDQN SLRKFSETIE KCLQENGSDR PTMGDVLWNL    660
EYAVQLQRGA NSMQRDPYEN SSSSVSTSLQ LPNVRRLPSL STLSEADDII VRHDESDSAV    720
DYVFSQLKID DAS*                                                      780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00180PKc1.0e-48396583192+
cd00192PTKc1.0e-49396657278+
pfam07714Pkinase_Tyr9.0e-50394586199+
smart00221STYKc5.0e-52394657280+
smart00219TyrKc3.0e-52393657281+
Gene Ontology
GO TermDescription
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0006468protein phosphorylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK52034.104227321311AF363826_1 Pto-like kinase SG5-3e [Phaseolus vulgaris]
GenBankAAK52035.104227321311AF363827_1 Pto-like kinase SG5-3d [Phaseolus vulgaris]
GenBankACM89523.13e-371712831115protein kinase family protein [Glycine max]
GenBankACM89523.10332732290690protein kinase family protein [Glycine max]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2qkw_B037766728317A Chain A, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto
PDB3hgk_D037766728317E Chain E, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto
PDB3hgk_C037766728317E Chain E, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto
PDB3hgk_B037766728317E Chain E, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto
PDB3hgk_A037766728317E Chain E, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto
Transmembrane Domains
StartEnd
307329
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7818113473887340
CV5293712793946720
FF5490072674667320
HO7853233753557270
DT4962052984036990
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01105.1Aquca_026_00194.1Aquca_036_00074.1
Arabidopsis thalianaAT1G28340.1
Brachypodium distachyonBradi1g26830.1
Brassica rapaBra032897
Carica papayaevm.model.supercontig_27.21
Capsella rubellaCarubv10008578m
Citrus clementinaCiclev10014874mCiclev10014609m
Citrus sinensisorange1.1g013887morange1.1g012913morange1.1g010819morange1.1g009515morange1.1g007860m
orange1.1g007307morange1.1g006793morange1.1g015373morange1.1g009603morange1.1g009236m
orange1.1g006940morange1.1g006035m
Cucumis sativusCucsa.147330.1Cucsa.126850.1
Eucalyptus grandisEucgr.G02346.3Eucgr.E03253.2Eucgr.E03253.1Eucgr.D00605.1
Fragaria vescamrna03872.1-v1.0-hybridmrna29734.1-v1.0-hybrid
Glycine maxGlyma02g11090.2Glyma02g11090.1Glyma01g22406.1Glyma20g32720.1Glyma15g08350.4
Glyma15g08350.3Glyma13g31020.4Glyma13g31020.3Glyma13g24550.1Glyma07g31970.1
Glyma07g31970.2
Gossypium raimondiiGorai.005G138000.3Gorai.005G138000.2Gorai.005G138000.1Gorai.011G029600.2Gorai.011G029600.1
Gorai.006G087900.8Gorai.006G087900.7Gorai.006G087900.6Gorai.006G087900.5Gorai.006G087900.4
Gorai.006G087900.3Gorai.006G087900.2Gorai.006G087900.1
Linum usitatissimumLus10041488Lus10034275Lus10015417Lus10013994Lus10015320
Malus domesticaMDP0000298053MDP0000124675
Manihot esculentacassava4.1_031190mcassava4.1_008047mcassava4.1_003726mcassava4.1_003546mcassava4.1_034042m
Medicago truncatulaMedtr5g053610.1Medtr2g014290.1
Mimulus guttatusmgv1a002935m
Oryza sativaLOC_Os07g31840.1
Panicum virgatumPavirv00022924mPavirv00022923mPavirv00008373m
Physcomitrella patensPp1s83_48V6.1Pp1s199_124V6.1Pp1s5_311V6.1Pp1s1_97V6.1Pp1s2_327V6.1
Pp1s6_364V6.1
Phaseolus vulgarisPhvul.007G102400.1Phvul.003G027500.1Phvul.006G183300.2Phvul.006G183300.1Phvul.002G230800.1
Picea abiesMA_199958g0010MA_41304g0010
Populus trichocarpaPotri.010G129300.3Potri.010G129300.2Potri.010G129300.1Potri.008G117000.2Potri.008G117000.1
Potri.011G056800.2Potri.011G056800.1Potri.004G047300.4Potri.004G047300.3Potri.004G047300.2
Potri.004G047300.1
Prunus persicappa002857mppa003081m
Ricinus communis29738.m00104930190.m011324
Setaria italicaSi029205m
Selaginella moellendorffii133089
Sorghum bicolorSb02g034070.1
Thellungiella halophilaThhalv10007074m
Vitis viniferaGSVIVT01021096001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)