y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.003G275200.1
FamilyGT92
Protein PropertiesLength: 501 Molecular Weight: 56605.9 Isoelectric Point: 9.3364
ChromosomeChromosome/Scaffold: 03 Start: 50135190 End: 50138411
DescriptionDomain of unknown function (DUF23)
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT922394540
  DYFYCGSSLYGNLNPQRVREWIAYHVKFFGPSSHFVIHDAGGVHEEVLEVLKPWMELGYVTVLDIRDEERFDGYYHNQFMVVNDCLHRYKFMAKWMFFFD
  VDEYIYVPPKTTIKTVLDSLSEYDQFTIEQMPMSSKICLSQDYGKTHRKWGFEKLVYRDSISGIRRDRKYAVQPRSLYATGVHMSQDLSGKTTHKTEGRI
  KYFHYHGTISERRESC
Full Sequence
Protein Sequence     Length: 501     Download
MAMASKEREK NVFFVGSLVN YAAELKLLLT VVLLLCGVAT LLQFLPSRFT ISSSDLRFCI    60
SRVSLQPPPL SSAPPPLPTP PPPPSSTPLF SNATIKRVFN TYGSAAYNFI NMGGYRGGLN    120
TFAIVGLSSK PLHVYGKPTY QCEWIPLQNT TFSSKPITTK GLKYLPDWGY GHVYTVVVVN    180
CTFNGTTVNA ANTGGKLVLH ASTSGAGDSN FNVTDRIEVL QEAPGSFNAS LFLSKPKYDY    240
FYCGSSLYGN LNPQRVREWI AYHVKFFGPS SHFVIHDAGG VHEEVLEVLK PWMELGYVTV    300
LDIRDEERFD GYYHNQFMVV NDCLHRYKFM AKWMFFFDVD EYIYVPPKTT IKTVLDSLSE    360
YDQFTIEQMP MSSKICLSQD YGKTHRKWGF EKLVYRDSIS GIRRDRKYAV QPRSLYATGV    420
HMSQDLSGKT THKTEGRIKY FHYHGTISER RESCKILVNT TQVTNDKIPY VLDTTLRDIA    480
GVIKKFEHKM IGSRLHNTKQ *                                              540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13704Glyco_tranf_2_40.000825834790+
pfam01697Glyco_transf_923.0e-23238431208+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_193750.1015001504unknown protein [Arabidopsis thaliana]
RefSeqNP_199280.1055002519unknown protein [Arabidopsis thaliana]
RefSeqXP_002263686.1055004526PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002299381.101125001387predicted protein [Populus trichocarpa]
RefSeqXP_002533995.101450021520conserved hypothetical protein [Ricinus communis]
Transmembrane Domains
StartEnd
1335
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO780532412905010
HO7963983781245010
CA8012822622314920
AM7237302901634520
EH7921893861164970
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00278.2Aquca_030_00278.1Aquca_007_00975.1
Arabidopsis lyrata492851494517902431
Arabidopsis thalianaAT5G44670.1AT4G20170.1AT2G33570.1AT5G48190.1AT3G60990.1
AT3G07380.1
Brachypodium distachyonBradi1g42556.1Bradi1g35710.2Bradi1g35710.1Bradi3g53170.1
Brassica rapaBra020933Bra033759Bra022944Bra005484
Carica papayaevm.model.supercontig_1291.2evm.model.supercontig_36.102
Capsella rubellaCarubv10004512mCarubv10026267mCarubv10023079m
Citrus clementinaCiclev10014882m
Citrus sinensisorange1.1g009350m
Cucumis sativusCucsa.049020.1
Eucalyptus grandisEucgr.E04328.1Eucgr.F03619.1
Fragaria vescamrna19924.1-v1.0-hybridmrna29146.1-v1.0-hybrid
Glycine maxGlyma09g05300.2Glyma15g16630.1Glyma16g14690.1Glyma08g36030.2
Gossypium raimondiiGorai.008G052100.1Gorai.007G359700.1Gorai.006G138000.1
Linum usitatissimumLus10008076Lus10038387Lus10024731Lus10036247
Malus domesticaMDP0000126481MDP0000126479MDP0000661922MDP0000203716
Manihot esculentacassava4.1_005572mcassava4.1_005594mcassava4.1_006235m
Medicago truncatulaMedtr8g070700.1
Mimulus guttatusmgv1a004537mmgv1a005071m
Oryza sativaLOC_Os06g22330.1LOC_Os02g48190.1LOC_Os06g41910.1
Panicum virgatumPavirv00018157mPavirv00039959mPavirv00055571mPavirv00069450mPavirv00047984m
Pavirv00032304m
Physcomitrella patensPp1s35_57V6.1Pp1s98_254V6.1Pp1s198_141V6.1Pp1s227_17V6.1Pp1s35_63V6.1
Pp1s32_144V6.1Pp1s112_159V6.1Pp1s237_6V6.1Pp1s225_53V6.1Pp1s556_1V6.1
Pp1s25_268V6.1Pp1s401_34V6.1Pp1s88_162V6.1
Phaseolus vulgarisPhvul.009G244900.1
Picea abiesMA_2788g0010MA_102296g0010MA_630451g0010MA_127644g0010MA_169299g0010
MA_43513g0010MA_401686g0010MA_10433350g0010MA_99230g0010MA_960165g0010.252.357
MA_960165g0010.252.357MA_960165g0010.360.466MA_960165g0010.360.466MA_898638g0010
Populus trichocarpaPotri.001G074600.1Potri.003G156600.1Potri.005G258900.1
Prunus persicappa004238mppa025548m
Ricinus communis28563.m00009330170.m014246
Setaria italicaSi017001mSi006264m
Selaginella moellendorffii77156406883
Sorghum bicolorSb10g013010.1Sb10g024570.1Sb04g030080.1
Thellungiella halophilaThhalv10024965mThhalv10000855mThhalv10016550m
Vitis viniferaGSVIVT01010061001GSVIVT01013454001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)