y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.003G278200.1
FamilyAA3
Protein PropertiesLength: 815 Molecular Weight: 89714.6 Isoelectric Point: 7.871
ChromosomeChromosome/Scaffold: 03 Start: 50355211 End: 50363667
DescriptionLong-chain fatty alcohol dehydrogenase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA32868080
  ISKKHEASNLSSPSLVIQCDAVVVGSGSGGGVAAGVLANAGYKVLVLEKGSYCARNNLSLLEGPSMDQMYLSNGLVATKDMSVLILAGSTVGGGSAVNWS
  ASIKTPQHVCKEWCDLHELELFESKLYREAMDAVCGKMGVQSEVEEEGFNNEVLRRGCLEMGYHVCNIPRNASSDHYCGWCCMGCKDGNKKSTSETWLVD
  LVKSGNGAIIPSCEAIQVLHKKKKGSEKKTARGVAFAIEYKGKKDICVVESKVTIVACGALSTPALLKKSGLKNENIGKNLHLHPVAMAWGYFPDSSSPK
  MWPEKHKKSYEGGIMTAMSTVVAQFDKTGYGAVIQTPSLHPGMFSILMPWTSGKDMKDRMHKFSRTAHVFALARDQGSGTVNSPSLISYELKDVDKENLE
  TGIEKVLRILAAAGAEEIGTHNNKGRSINVKQVSYHEFEKFVKEESSMSLTDLTTPLCSAHQMGSCKMGTNPSDSVVNQMGETWEVEGLYLADTSVFPTA
  LGVNPMVTVQAIAYCTAQYVAEV
Full Sequence
Protein Sequence     Length: 815     Download
MENNGESHSR SASFRMGFGL SVNEAKVHTV LHLGTPTLLH AHGDADVGDE ERDKHQKPLT    60
NSLSPRQMKS LVALCDTIIP SIDNNVVRSS DDESVANFYK TSASMAGTPQ HLGKLISEKV    120
KHPSTWLLLL TLWLLSTWFG TLILCGMASV SSRFPFFHSY PEMSLLKRQR VMQSWSLSYL    180
RPLRMFFRTI KLLTLLTFFT QVDEAEENPS WKAIGYCGPD PEFKAQLKNN FLHRTSKEEQ    240
HQKKDDDDDE EEEFRGPLHK GLVHLNYPRD MIKNSLRRFG FSVSTISKKH EASNLSSPSL    300
VIQCDAVVVG SGSGGGVAAG VLANAGYKVL VLEKGSYCAR NNLSLLEGPS MDQMYLSNGL    360
VATKDMSVLI LAGSTVGGGS AVNWSASIKT PQHVCKEWCD LHELELFESK LYREAMDAVC    420
GKMGVQSEVE EEGFNNEVLR RGCLEMGYHV CNIPRNASSD HYCGWCCMGC KDGNKKSTSE    480
TWLVDLVKSG NGAIIPSCEA IQVLHKKKKG SEKKTARGVA FAIEYKGKKD ICVVESKVTI    540
VACGALSTPA LLKKSGLKNE NIGKNLHLHP VAMAWGYFPD SSSPKMWPEK HKKSYEGGIM    600
TAMSTVVAQF DKTGYGAVIQ TPSLHPGMFS ILMPWTSGKD MKDRMHKFSR TAHVFALARD    660
QGSGTVNSPS LISYELKDVD KENLETGIEK VLRILAAAGA EEIGTHNNKG RSINVKQVSY    720
HEFEKFVKEE SSMSLTDLTT PLCSAHQMGS CKMGTNPSDS VVNQMGETWE VEGLYLADTS    780
VFPTALGVNP MVTVQAIAYC TAQYVAEVLR RKTK*                               840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK02106PRK021064.0e-574678439+
pfam05199GMC_oxred_C1.0e-21672799128+
COG2303BetA9.0e-33327807544+
pfam00732GMC_oxred_N8.0e-68351571226+
Gene Ontology
GO TermDescription
GO:0016614oxidoreductase activity, acting on CH-OH group of donors
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI29206.106181433649unnamed protein product [Vitis vinifera]
RefSeqNP_193673.20688121725alcohol oxidase-related [Arabidopsis thaliana]
RefSeqXP_002269629.106181433788PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002328753.10688121744predicted protein [Populus trichocarpa]
RefSeqXP_002519938.101118127708electron carrier, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3t37_A0.0000130380417520A Chain A, Crystal Structure Of Pyridoxine 4-Oxidase From Mesorbium Loti
PDB1naa_B0.000053055744283A Chain A, Cellobiose Dehydrogenase Flavoprotein Fragment In Complex With Cellobionolactam
PDB1naa_A0.000053055744283A Chain A, Cellobiose Dehydrogenase Flavoprotein Fragment In Complex With Cellobionolactam
PDB1kdg_B0.000053055749288A Chain A, Crystal Structure Of The Flavin Domain Of Cellobiose Dehydrogenase
PDB1kdg_A0.000053055749288A Chain A, Crystal Structure Of The Flavin Domain Of Cellobiose Dehydrogenase
Transmembrane Domains
StartEnd
126148
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DC8838504623518120
HO7947536671518090
GO0218952605518100
CX7071652325818120
DY2609542485658120
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_089_00009.1Aquca_049_00132.1Aquca_034_00307.1Aquca_034_00304.1
Arabidopsis lyrata914728491906479855470376
Arabidopsis thalianaAT4G19380.1AT4G28570.1AT3G23410.1AT1G03990.1
Brachypodium distachyonBradi3g28677.1Bradi3g28657.1Bradi3g49085.1
Brassica rapaBra012548Bra024190Bra013391Bra015283Bra001912
Bra014947
Carica papayaevm.model.supercontig_165.33evm.model.supercontig_44.31evm.model.supercontig_2124.1
Capsella rubellaCarubv10004418mCarubv10004208mCarubv10012453mCarubv10004212mCarubv10013046m
Citrus clementinaCiclev10011111mCiclev10004403mCiclev10004405mCiclev10018992m
Citrus sinensisorange1.1g003990morange1.1g004496m
Cucumis sativusCucsa.037200.2Cucsa.037200.1Cucsa.035240.1Cucsa.255570.1
Eucalyptus grandisEucgr.H03017.2Eucgr.H03017.1Eucgr.H00753.1Eucgr.K02114.1Eucgr.D02566.1
Eucgr.D02568.1
Fragaria vescamrna08288.1-v1.0-hybridmrna11513.1-v1.0-hybridmrna08285.1-v1.0-hybrid
Glycine maxGlyma09g35210.2Glyma01g35620.1Glyma16g16415.1Glyma16g08300.2Glyma10g32640.2
Glyma12g15940.1Glyma19g34960.1Glyma06g42400.2Glyma03g32220.2
Gossypium raimondiiGorai.001G179800.3Gorai.001G179800.2Gorai.001G179800.1Gorai.011G177100.3Gorai.011G177100.2
Gorai.011G177100.1Gorai.006G252500.1
Linum usitatissimumLus10003621Lus10024922Lus10035673Lus10008239Lus10022903
Lus10037257Lus10011800
Malus domesticaMDP0000233110MDP0000173300MDP0000208936MDP0000197715
Manihot esculentacassava4.1_004067mcassava4.1_002349mcassava4.1_002619mcassava4.1_002379mcassava4.1_025870m
Medicago truncatulaMedtr5g025650.1Medtr8g072210.1Medtr4g081080.1Medtr1g075650.1Medtr4g080890.1
Mimulus guttatusmgv1a001761mmgv1a022390mmgv1a001868mmgv1a001883mmgv1a001896m
Oryza sativaLOC_Os10g33540.1LOC_Os10g33520.1LOC_Os10g33460.1LOC_Os02g40840.1
Panicum virgatumPavirv00054947m
Physcomitrella patensPp1s58_61V6.1Pp1s7_216V6.1Pp1s48_250V6.1Pp1s2_413V6.1
Phaseolus vulgarisPhvul.002G122600.1Phvul.007G124200.1Phvul.001G162800.1Phvul.011G136600.1
Picea abiesMA_10427118g0010MA_9032943g0010MA_9483g0010MA_10427421g0010MA_242814g0010
Populus trichocarpaPotri.004G234900.2Potri.004G234900.1Potri.010G069100.1Potri.008G169300.1Potri.002G259700.1
Prunus persicappa014756mppa018458mppa021498m
Ricinus communis29827.m00265529981.m00058628492.m000467
Setaria italicaSi034362mSi034354mSi034359mSi016380m
Selaginella moellendorffii1140891168557460173531
Sorghum bicolorSb01g019470.1Sb01g019460.1Sb01g019480.1Sb04g026370.1Sb04g026390.1
Thellungiella halophilaThhalv10024717mThhalv10024496mThhalv10024528mThhalv10020141mThhalv10006882m
Vitis viniferaGSVIVT01036891001GSVIVT01027855001GSVIVT01028371001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)