y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.003G278500.1
FamilyGT77
Protein PropertiesLength: 446 Molecular Weight: 50574.2 Isoelectric Point: 7.1176
ChromosomeChromosome/Scaffold: 03 Start: 50402381 End: 50406094
Descriptionxyloglucanase 113
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771503740
  VSNFLVGAMDTKLLEALYWKGIPVFDMGSHMSTVDVGWGSPTFHKMGREKVILIDSILPFGFELLMCDTDMVWLKNPLPYLARYPEADVLTSSDQVIPTV
  VDDSLEVWQEVSGAYNIGIFHWRPTESAKKLAKQWKEMLLADDKIWDQNGFNDILHKQLGPAVDDESALVFAFDGKLKMGILPASIFCSGHTYFVQAMYQ
  QLRLEPYAVHTTFQYGGTEGKRHRL
Full Sequence
Protein Sequence     Length: 446     Download
MAWRKGCEEV ANSKPLFLTI YTVVVIGIVV SSFYVFSAIY SSNPSAAQSS AWLSSLPSEN    60
TRVTDQTLNV SRSAVHFVPR PSSGAQNEWS RTIWDIPPTN KRMPPLSDFR LTKALVQQRV    120
KDNVVIVTFG NYAFMDFILT WVKQLRDLEV SNFLVGAMDT KLLEALYWKG IPVFDMGSHM    180
STVDVGWGSP TFHKMGREKV ILIDSILPFG FELLMCDTDM VWLKNPLPYL ARYPEADVLT    240
SSDQVIPTVV DDSLEVWQEV SGAYNIGIFH WRPTESAKKL AKQWKEMLLA DDKIWDQNGF    300
NDILHKQLGP AVDDESALVF AFDGKLKMGI LPASIFCSGH TYFVQAMYQQ LRLEPYAVHT    360
TFQYGGTEGK RHRLREAMLF LDPPEYYNPP GGFLSFKPHI PKGLLLSGEH NVESHFTLVN    420
YQIKQIRTAL AIASLLNRTL VRTNFW                                         480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans2.0e-50150374231+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAH19600.1024464455AT2G35610 [Arabidopsis thaliana]
EMBLCBI29197.108644694454unnamed protein product [Vitis vinifera]
RefSeqNP_850250.1024464455unknown protein [Arabidopsis thaliana]
RefSeqXP_002328759.108144684449predicted protein [Populus trichocarpa]
RefSeqXP_002519934.1034464451reticulon3-A3, putative [Ricinus communis]
Transmembrane Domains
StartEnd
1537
123142
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT5119933041244270
GR7084012981364330
DT5670462841474300
GO0388052521293800
GR7084052701364050
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00317.5Aquca_011_00317.4Aquca_011_00317.3Aquca_011_00317.2Aquca_011_00317.1
Arabidopsis lyrata902666
Arabidopsis thalianaAT2G35610.1
Brachypodium distachyonBradi1g15410.1Bradi3g45950.1
Brassica rapaBra017310Bra005325
Carica papayaevm.model.supercontig_90.39
Capsella rubellaCarubv10022808m
Chlamydomonas reinhardtiig13982.t1g15149.t1Cre02.g082950.t1.3Cre01.g000400.t1.2Cre01.g000450.t1.2
g4580.t1Cre07.g340950.t1.3Cre04.g224350.t1.3Cre01.g000500.t1.3Cre09.g416650.t1.2
Cre13.g574100.t1.2Cre13.g574041.t1.1Cre13.g574050.t1.2Cre07.g332500.t1.2
Citrus clementinaCiclev10011269m
Citrus sinensisorange1.1g036925m
Cucumis sativusCucsa.018320.1Cucsa.018320.10Cucsa.018320.3
Eucalyptus grandisEucgr.E01147.2Eucgr.E01147.1
Fragaria vescamrna10921.1-v1.0-hybrid
Glycine maxGlyma11g09650.2Glyma01g35690.1Glyma16g08350.1Glyma16g20730.1Glyma16g08350.3
Glyma16g08350.2
Gossypium raimondiiGorai.004G177500.4Gorai.008G219000.2Gorai.004G177500.5Gorai.004G177500.6Gorai.004G177500.7
Gorai.004G177500.9Gorai.004G177500.2Gorai.004G177500.3Gorai.004G177500.1Gorai.008G219000.1
Gorai.004G177500.8
Linum usitatissimumLus10005034Lus10027804
Malus domesticaMDP0000349223
Manihot esculentacassava4.1_003398mcassava4.1_008884m
Medicago truncatulaMedtr8g072310.1Medtr5g025590.1
Mimulus guttatusmgv1a002766m
Oryza sativaLOC_Os03g38930.1
Panicum virgatumPavirv00057126mPavirv00045617mPavirv00069114m
Physcomitrella patensPp1s46_165V6.1
Phaseolus vulgarisPhvul.002G122000.1
Picea abiesMA_486176g0010MA_10433213g0010
Populus trichocarpaPotri.004G235800.1Potri.004G235800.2
Prunus persicappa002815m
Ricinus communis29827.m002651
Setaria italicaSi034728m
Selaginella moellendorffii127789
Sorghum bicolorSb01g015590.1
Thellungiella halophilaThhalv10016368m
Vitis viniferaGSVIVT01036881001
Volvox carteriVocar20007251mVocar20009385mVocar20010418mVocar20002020mVocar20004159m
Vocar20001219mVocar20001335mVocar20001723mVocar20006862mVocar20009663m
Vocar20008350mVocar20001348m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)