y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.003G282000.1
FamilyCE10
Protein PropertiesLength: 463 Molecular Weight: 51087 Isoelectric Point: 8.3329
ChromosomeChromosome/Scaffold: 03 Start: 50770117 End: 50778548
Descriptionalpha/beta-Hydrolases superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE101654320
  RSIVYGDKPRNRLDLYLPKNSSGPKPVVAFITGGAWIIGYKAWGTLLGQQLSERDIIVACIDYRNFPQGTISDMIADSSQGIAFVCNNIAEYGGDPNRIY
  LMGQSAGAHIAACVIVEQAIKEAGEGESTSWSLSQIKTYFGLSGGYNLFNLVEHFHSRGLYRSIFLSIMEGEESLKRFSPEVMIQDPNIGNANSLLPPVV
  LFHGTGDYSIPSDASKTFAETLQKVGVTAESIMYEGKTHTDVFLQDPMRGGKDDMFEDLVGYIHAGDA
Full Sequence
Protein Sequence     Length: 463     Download
MPSQIFPTSN RSLDSAVSTS SAAFIRPKED ENDPSVSLLD HSAPSFRDMS LKPPLPRASS    60
FTTSRNKPSR PRHSFNQKRR RRAASQDSFP CVSDHSDTAI RSSFGRDVAA ETFLLTRLGF    120
KLLGYLGVGY KWISRFLALS CYALLLFPGF IQVGYYYFFS SQIRRSIVYG DKPRNRLDLY    180
LPKNSSGPKP VVAFITGGAW IIGYKAWGTL LGQQLSERDI IVACIDYRNF PQGTISDMIA    240
DSSQGIAFVC NNIAEYGGDP NRIYLMGQSA GAHIAACVIV EQAIKEAGEG ESTSWSLSQI    300
KTYFGLSGGY NLFNLVEHFH SRGLYRSIFL SIMEGEESLK RFSPEVMIQD PNIGNANSLL    360
PPVVLFHGTG DYSIPSDASK TFAETLQKVG VTAESIMYEG KTHTDVFLQD PMRGGKDDMF    420
EDLVGYIHAG DAEARARDAV APPRRRLVPE CMLKLAHSVS PF*                      480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1506DAP21.0e-9179403247+
pfam00135COesterase2.0e-10179276121+
COG2272PnbA4.0e-12177276118+
pfam07859Abhydrolase_34.0e-12194403221+
COG0657Aes5.0e-23164403249+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_173937.2014621476esterase-related [Arabidopsis thaliana]
RefSeqXP_002264962.1010146253417PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002277990.1014621458PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315969.1014621517predicted protein [Populus trichocarpa]
RefSeqXP_002514516.1010946292445catalytic, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2c7b_B0.0000000000817640361281A Chain A, The Crystal Structure Of Este1, A New Thermophilic And Thermostable Carboxylesterase Cloned From A Metagenomic Library
PDB2c7b_A0.0000000000817640361281A Chain A, The Crystal Structure Of Este1, A New Thermophilic And Thermostable Carboxylesterase Cloned From A Metagenomic Library
PDB2hm7_A0.00000000217640361282A Chain A, Crystal Structure Analysis Of The G84s Est2 Mutant
PDB1evq_A0.00000000317640361282A Chain A, The Crystal Structure Of The Thermophilic Carboxylesterase Est2 From Alicyclobacillus Acidocaldarius
PDB1jmy_A0.00000000415927265197A Chain A, Truncated Recombinant Human Bile Salt Stimulated Lipase
Transmembrane Domains
StartEnd
136158
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GE4792562991304270
DY2779683411014300
CV53487022612260
DY280956313743830
FC9017262521013490
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01054.1Aquca_026_00158.1Aquca_002_01054.2Aquca_002_01054.3
Arabidopsis lyrata472805488435871523
Arabidopsis thalianaAT5G15860.1AT3G02410.2AT3G02410.1AT1G26120.1AT5G15860.2
Brachypodium distachyonBradi2g44942.1Bradi1g34707.1Bradi2g15577.1
Brassica rapaBra023542Bra039174Bra024729Bra011010
Carica papayaevm.model.supercontig_179.40evm.model.supercontig_1.241
Capsella rubellaCarubv10009035mCarubv10013836mCarubv10001044m
Chlamydomonas reinhardtiiCre02.g119050.t1.3Cre02.g119100.t1.2Cre04.g221000.t1.2
Citrus clementinaCiclev10031407mCiclev10012228mCiclev10012226mCiclev10011876mCiclev10031505m
Ciclev10032121m
Citrus sinensisorange1.1g011866morange1.1g021014morange1.1g015512morange1.1g015857morange1.1g015669m
orange1.1g012898morange1.1g027370morange1.1g020616m
Cucumis sativusCucsa.284050.2Cucsa.284050.1Cucsa.031590.2Cucsa.031590.1Cucsa.031590.3
Cucsa.023750.1
Eucalyptus grandisEucgr.J01457.1Eucgr.B03069.1Eucgr.B03069.3Eucgr.B03069.2
Fragaria vescamrna10342.1-v1.0-hybridmrna04471.1-v1.0-hybrid
Glycine maxGlyma16g18930.1Glyma19g05450.1
Gossypium raimondiiGorai.013G079100.1Gorai.001G082500.7Gorai.001G082500.4Gorai.001G082500.3Gorai.001G082500.2
Gorai.001G082500.10Gorai.001G082500.1Gorai.001G082500.5Gorai.001G082500.8Gorai.001G082500.6
Gorai.013G079100.2Gorai.001G082500.9Gorai.001G082500.11
Linum usitatissimumLus10034399Lus10034083Lus10035064Lus10003065Lus10017889
Lus10019156
Malus domesticaMDP0000150270MDP0000199618MDP0000148927
Manihot esculentacassava4.1_007743mcassava4.1_008765m
Medicago truncatulaAC233657_38.1
Mimulus guttatusmgv1a005715mmgv1a006071mmgv1a007008m
Oryza sativaLOC_Os06g49440.1LOC_Os05g50170.2LOC_Os05g50170.1LOC_Os01g45460.1
Panicum virgatumPavirv00062556mPavirv00037181mPavirv00069964mPavirv00069963mPavirv00008713m
Pavirv00033569mPavirv00037182mPavirv00029918m
Physcomitrella patensPp1s196_45V6.1Pp1s62_226V6.1Pp1s74_172V6.1Pp1s131_174V6.1
Phaseolus vulgarisPhvul.002G197000.1
Picea abiesMA_10277324g0010
Populus trichocarpaPotri.004G104800.4Potri.004G104800.2Potri.004G104800.1Potri.T099800.1Potri.017G110700.2
Potri.017G110700.1Potri.010G132200.3Potri.010G132200.2Potri.010G132200.1Potri.004G104800.3
Potri.010G132200.4Potri.004G104800.5
Prunus persicappa006567mppa005357m
Ricinus communis28583.m00011030138.m00382932825.m000025
Setaria italicaSi006248mSi001677mSi001674mSi025328m
Selaginella moellendorffii17024680622
Sorghum bicolorSb10g029410.1Sb03g029280.1
Thellungiella halophilaThhalv10013599mThhalv10020771mThhalv10007556m
Vitis viniferaGSVIVT01030706001GSVIVT01012000001
Volvox carteriVocar20003581mVocar20003648m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)