y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.003G292000.1
FamilyGT10
Protein PropertiesLength: 512 Molecular Weight: 57232.4 Isoelectric Point: 8.3717
ChromosomeChromosome/Scaffold: 03 Start: 51780902 End: 51785798
Descriptionfucosyltransferase 11
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT101493880
  DAAFGLPQPSGTASVLRSMESAKYYAENNIAMARRRGYNIIMTTSLSSDVPVGYFSWAEYDMMAPVQPKTEAALAAAFISNCGARNFRLQALEALEKLNI
  KIDSYGGCHRNRDGRVSKVEALKHYKFSLAFENSNEEDYVTEKFFQSLVAGTVPVVVGAPNIQDFAPSPGSILHIKEIEDVESVAKTMRYLSENPEAYNQ
  SLRWKYEGPSDSFKALVDMAAVHSSCRLCIHLATVSREKE
Full Sequence
Protein Sequence     Length: 512     Download
MMGLVTNLRR SRTEGAQQES MPVLAPGGNP KRKWSNLMPL VVAFVVIAEI AFLGRLDMAK    60
NAAMVDTLAD LFYRSRAVVE GDDLGMGGLV APDRNSESDS CEEWLEREDA VTYSRDFSKD    120
PVFVSRAVQE WKTCSIGCKF GFSGDKKPDA AFGLPQPSGT ASVLRSMESA KYYAENNIAM    180
ARRRGYNIIM TTSLSSDVPV GYFSWAEYDM MAPVQPKTEA ALAAAFISNC GARNFRLQAL    240
EALEKLNIKI DSYGGCHRNR DGRVSKVEAL KHYKFSLAFE NSNEEDYVTE KFFQSLVAGT    300
VPVVVGAPNI QDFAPSPGSI LHIKEIEDVE SVAKTMRYLS ENPEAYNQSL RWKYEGPSDS    360
FKALVDMAAV HSSCRLCIHL ATVSREKEEK SPSFKRRPCK CTRGLQTVYH IYVRERGRFE    420
MESIYLRSGN LTLDSVKAAV VLKFTSKNHV PVWKTERPEV IRGGTDLKLY KIYPIGLTQR    480
QALYTFSFKG DADFRSHLEN NPCAKFEVIF V*                                  540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00852Glyco_transf_103.0e-26187381204+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008417fucosyltransferase activity
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAL99370.1025111506alpha 1,3 fucosyltransferase [Medicago sativa]
GenBankAAL99371.1025111505alpha 1,3 fucosyltransferase [Medicago sativa]
GenBankAAS66306.1025111504core alpha 1,3-fucosyltransferase [Medicago truncatula]
EMBLCAB52254.1015111510Fuct c3 protein [Vigna radiata var. radiata]
RefSeqXP_002313854.1025111523predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2nzy_C0.000000004224360183315A Chain A, High Resolution X-Ray Structure Of Human Galectin-3 In Complex With Lacnac
PDB2nzy_B0.000000004224360183315A Chain A, High Resolution X-Ray Structure Of Human Galectin-3 In Complex With Lacnac
PDB2nzy_A0.000000004224360183315A Chain A, High Resolution X-Ray Structure Of Human Galectin-3 In Complex With Lacnac
PDB2nzx_C0.000000004224360183315A Chain A, High Resolution X-Ray Structure Of Human Galectin-3 In Complex With Lacnac
PDB2nzx_B0.000000004224360183315A Chain A, High Resolution X-Ray Structure Of Human Galectin-3 In Complex With Lacnac
Transmembrane Domains
StartEnd
3456
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO788660269533210
DT7327912822044850
EH7361072581474040
CO0767162591584160
JG8664882821344150
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00060.3Aquca_015_00060.1Aquca_015_00060.2
Arabidopsis lyrata891881891885479443
Arabidopsis thalianaAT3G19280.1AT1G49710.1
Brachypodium distachyonBradi3g38160.2Bradi3g38160.1
Brassica rapaBra014210Bra018801Bra022408
Carica papayaevm.model.supercontig_62.7
Capsella rubellaCarubv10015682mCarubv10008875m
Chlamydomonas reinhardtiig18110.t1
Citrus clementinaCiclev10028212m
Citrus sinensisorange1.1g038682m
Cucumis sativusCucsa.219830.2Cucsa.219830.1Cucsa.219830.4Cucsa.244420.1Cucsa.219830.5
Cucsa.219830.3
Eucalyptus grandisEucgr.I01147.2Eucgr.I01147.1Eucgr.I01147.3
Fragaria vescamrna28254.1-v1.0-hybrid
Glycine maxGlyma07g33580.1Glyma02g14890.1Glyma07g33580.2
Gossypium raimondiiGorai.013G044300.2Gorai.002G008200.2Gorai.008G024900.1Gorai.013G044300.1Gorai.002G008200.1
Linum usitatissimumLus10027899Lus10014060Lus10002401Lus10019855
Malus domesticaMDP0000275804MDP0000322244
Manihot esculentacassava4.1_005385mcassava4.1_009428m
Medicago truncatulaMedtr4g086010.1
Mimulus guttatusmgv1a005269m
Oryza sativaLOC_Os08g36840.1
Panicum virgatumPavirv00032486m
Physcomitrella patensPp1s31_233V6.3Pp1s31_233V6.1
Picea abiesMA_100562g0010
Populus trichocarpaPotri.009G101500.3Potri.009G101500.4Potri.009G101500.1Potri.009G101500.2
Prunus persicappa004581m
Ricinus communis29801.m003181
Setaria italicaSi013627m
Selaginella moellendorffii164166
Sorghum bicolorSb07g022980.1
Thellungiella halophilaThhalv10011402m
Vitis viniferaGSVIVT01031736001
Volvox carteriVocar20004454m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny