y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.004G022500.1
FamilyGH38
Protein PropertiesLength: 1153 Molecular Weight: 131692 Isoelectric Point: 7.3601
ChromosomeChromosome/Scaffold: 04 Start: 2296294 End: 2302991
Descriptiongolgi alpha-mannosidase II
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH381434820
  KVFVVPHSHNDPGWKLTVEEYYDRQSRHILDTIVQTLTKDSRRKFIWEEMSYLERWWRDASDEMKESFINLVKNGQLEIVGGGWVMNDEANSHYFAIIEQ
  IAEGNMWLNDTIGFVPKNSWAIDPFGYSSTMAYLLRRMGFDNMLIQRTHYEVKKELAWHKKLEYIWRQSWDADETTDIFVHMMPFYSYDIPHTCGPEPAI
  CCQFDFARMQGFVYEQCPWGQYPVETTLENVQERALKLLDQYRKKSTLYRTNTLLVPLGDDFRYINVEEAEAQFRNYQMLFDYINSNPSLNAEAKFGTLE
  DYFVTLREEAERINYSFPGEIGSGLVEGFPSLSGDFFTYS
Full Sequence
Protein Sequence     Length: 1153     Download
MPSSSRRGAA WASSILPSSN PKSKAPRKGR RRTVLKDFIF SNFFSIGLVI SLSLFLLILL    60
RFGVPKPIAT HFRTRSSRAR KSFGRRPLPT VFNTSALAGA GAVDITTKAL YDKIEFLDVD    120
GGAWKQGWSV TYRGNEWDAE KLKVFVVPHS HNDPGWKLTV EEYYDRQSRH ILDTIVQTLT    180
KDSRRKFIWE EMSYLERWWR DASDEMKESF INLVKNGQLE IVGGGWVMND EANSHYFAII    240
EQIAEGNMWL NDTIGFVPKN SWAIDPFGYS STMAYLLRRM GFDNMLIQRT HYEVKKELAW    300
HKKLEYIWRQ SWDADETTDI FVHMMPFYSY DIPHTCGPEP AICCQFDFAR MQGFVYEQCP    360
WGQYPVETTL ENVQERALKL LDQYRKKSTL YRTNTLLVPL GDDFRYINVE EAEAQFRNYQ    420
MLFDYINSNP SLNAEAKFGT LEDYFVTLRE EAERINYSFP GEIGSGLVEG FPSLSGDFFT    480
YSDRQQDYWS GYYVSRPFFK AVDRVLEQTL RATEIMVALI LGCCRRSHCE KFAMGFSYKL    540
TAARRNLALF QHHDGVTGTA KDHVVMDYGM RMHTSLLDLQ IFMSKAVEAL LGIRYDKLDH    600
SPSQFEPAIV RSKYDAQPLH KVIGVHDGTY QSVVFFNPLE QTSQEVVMLV VDSPDVTVVD    660
SNWSCVQSQI LPELQHHNSK IFTGKHRLYW EVSVPALGLE TYYISNGFDE CEKAKPAKLK    720
IFSKSNSIAC PTPYSCVKIE SDVAEIENQN QKLTFDVKYG LLQKIISKNS SPNIVKEEIG    780
LYSSSGGAYL FKPNGDAQPF IEEGGQLLIS EGPLMQEVYS YPRTTWEKAP ISHSTRIYSG    840
ESTVQGFIIE KEYHVELLGH DFNDKELIVR YKTDIDNKKI FYSDLNGFQM SRRETYDKIP    900
LQGNYYPLPS LAFIQGSNGH RFSVHSRQSL GVASLKNGWL EIMLDRRLVR DDGRGLGQGV    960
MDNRVMNVVF HLTMETNVSA TSNLVSTPFA YSPSLLSHCV GSHLNYPLHA FISKKPQDKS    1020
AKPPPRSFSP LAAPLPCDLH IVNFKVPKPL KFLQQPAEGP RFALIFHRRH WDSSYCRKGR    1080
SQCTNLGDVT VNLFSMFQDL TVSKVKATSL NLLHEDPEVM GFSEQFGDLA QEGHVAISPM    1140
EIQAYKLELR PQ*                                                       1200
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00451GH38N_AMII_euk1.0e-108142428288+
cd11667GH38N_Man2A23.0e-148142493352+
cd11666GH38N_Man2A12.0e-155142493352+
PLN02701PLN02701010311501051+
cd10809GH38N_AMII_GMII_SfManIII_like0141493353+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004559alpha-mannosidase activity
GO:0005975carbohydrate metabolic process
GO:0006013mannose metabolic process
GO:0008270zinc ion binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI35021.101115111056unnamed protein product [Vitis vinifera]
RefSeqNP_196999.10111152221172GMII (GOLGI ALPHA-MANNOSIDASE II); alpha-mannosidase [Arabidopsis thaliana]
RefSeqXP_002276468.101115111149PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002438145.10561151711178hypothetical protein SORBIDRAFT_10g008770 [Sorghum bicolor]
RefSeqXP_002517418.1031152211179mannosidase alpha class 2a, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1hxk_A0103101211903A Chain A, Golgi Alpha-Mannosidase Ii In Complex With Deoxymannojirimicin
PDB1hww_A0103101211903A Chain A, Golgi Alpha-Mannosidase Ii In Complex With Deoxymannojirimicin
PDB1hty_A0103101211903A Chain A, Golgi Alpha-Mannosidase Ii
PDB1ps3_A0103101241933A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine
PDB3eju_A0103101241933A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine
Transmembrane Domains
StartEnd
3860
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7891222731474190
FL7143862732295010
CB6620862812735530
GR3180372661033680
FN7613372502504990
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00345.1.265.483Aquca_002_00345.1.265.483Aquca_006_00230.1Aquca_006_00257.5Aquca_006_00257.9
Aquca_006_00257.8Aquca_006_00257.7Aquca_006_00257.6Aquca_006_00257.4Aquca_006_00257.3
Aquca_006_00257.2Aquca_006_00257.1Aquca_043_00016.7Aquca_043_00016.8Aquca_043_00016.6
Aquca_043_00016.5Aquca_043_00016.4Aquca_043_00016.3Aquca_043_00016.2Aquca_043_00016.1
Aquca_043_00019.2Aquca_043_00019.1Aquca_043_00018.1Aquca_056_00071.1Aquca_002_00345.1.162.261
Aquca_002_00345.1.162.261
Arabidopsis lyrata488339488225497001484445
Arabidopsis thalianaAT5G14950.1AT5G66150.1AT5G13980.3AT5G13980.2AT5G13980.1
AT3G26720.2AT3G26720.1
Brachypodium distachyonBradi1g44550.1Bradi3g21117.1Bradi4g17327.1Bradi4g17317.1
Brassica rapaBra023496Bra006275Bra037183Bra006227Bra025225
Carica papayaevm.model.supercontig_6.275evm.model.supercontig_70.70evm.model.supercontig_2646.1evm.TU.contig_36966.1evm.model.supercontig_70.69
Capsella rubellaCarubv10000075mCarubv10002909mCarubv10027738mCarubv10016625m
Citrus clementinaCiclev10014083mCiclev10017635mCiclev10024829mCiclev10024800mCiclev10030627m
Ciclev10014156mCiclev10014160mCiclev10014123m
Citrus sinensisorange1.1g002547morange1.1g002518morange1.1g002134morange1.1g001061morange1.1g015028m
orange1.1g002366morange1.1g004057morange1.1g001910morange1.1g001850morange1.1g002764m
orange1.1g002170morange1.1g002162morange1.1g002383morange1.1g001963morange1.1g001813m
orange1.1g002938morange1.1g002542morange1.1g002064morange1.1g002056morange1.1g002046m
orange1.1g002036m
Cucumis sativusCucsa.339310.1Cucsa.043720.1Cucsa.188400.2Cucsa.188400.1
Eucalyptus grandisEucgr.J02166.1Eucgr.L01536.1Eucgr.J02456.1Eucgr.K02195.1Eucgr.J02455.3
Eucgr.J02455.2Eucgr.J02455.1Eucgr.I01600.1Eucgr.G01931.1Eucgr.J02460.1
Eucgr.J02454.1Eucgr.L01537.1Eucgr.J02457.1Eucgr.J02459.2Eucgr.J02459.1
Fragaria vescamrna28330.1-v1.0-hybridmrna14585.1-v1.0-hybridmrna01394.1-v1.0-hybrid.37.348mrna01394.1-v1.0-hybrid.37.348mrna06416.1-v1.0-hybrid.39.351
mrna06416.1-v1.0-hybrid.39.351mrna14589.1-v1.0-hybrid.71.344
Glycine maxGlyma13g04761.3Glyma13g04761.2Glyma19g01890.1Glyma13g04761.1Glyma02g05240.2
Glyma02g05240.1Glyma16g23600.1Glyma01g36980.1Glyma06g17270.1Glyma04g37790.1
Glyma19g27660.2Glyma19g27660.1Glyma16g05240.2Glyma16g05240.1
Gossypium raimondiiGorai.001G258600.2Gorai.001G258600.1Gorai.006G027500.1Gorai.003G008600.2Gorai.003G008600.1
Gorai.006G000300.3Gorai.006G000300.2Gorai.006G000300.1Gorai.012G082700.6Gorai.012G082700.9
Gorai.012G082700.8Gorai.012G082700.7Gorai.012G082700.5Gorai.012G082700.4Gorai.012G082700.3
Gorai.012G082700.2Gorai.012G082700.10Gorai.012G082700.1Gorai.003G116600.2Gorai.003G116600.1
Linum usitatissimumLus10014507Lus10015337.248.571Lus10015337.248.571Lus10032179Lus10039457
Lus10012578Lus10035111Lus10012577Lus10036074Lus10025960
Lus10014259Lus10041516Lus10015337.158.248Lus10015337.158.248
Malus domesticaMDP0000888429MDP0000267909MDP0000250936MDP0000139458MDP0000274501
MDP0000274500MDP0000409920MDP0000163211MDP0000657082MDP0000211018
Manihot esculentacassava4.1_000571mcassava4.1_001602mcassava4.1_000993mcassava4.1_000971mcassava4.1_000869m
cassava4.1_001123mcassava4.1_001106m
Medicago truncatulaMedtr4g071680.1Medtr6g008850.1Medtr8g075330.1Medtr7g084040.1Medtr3g098650.2
Medtr3g098650.1Medtr7g084030.1
Mimulus guttatusmgv1a000435mmgv1a000658mmgv1a000852mmgv1a000690m
Oryza sativaLOC_Os06g13650.2LOC_Os06g13650.1LOC_Os06g13650.3LOC_Os11g32260.2LOC_Os11g32260.1
LOC_Os10g05069.2LOC_Os10g05069.1LOC_Os10g05069.3
Panicum virgatumPavirv00027286mPavirv00014532mPavirv00024149mPavirv00025946mPavirv00065120m
Physcomitrella patensPp1s10_34V6.1Pp1s77_136V6.1Pp1s129_147V6.1
Phaseolus vulgarisPhvul.003G264400.1Phvul.001G084400.1Phvul.002G107300.1Phvul.001G084700.1Phvul.009G161600.1
Picea abiesMA_10434251g0010MA_879613g0010MA_4107059g0010
Populus trichocarpaPotri.017G073900.2Potri.017G073900.1Potri.001G350400.2Potri.001G350400.1Potri.014G143600.1
Potri.014G143600.2Potri.007G056300.1Potri.002G238200.2Potri.002G238200.1Potri.012G106500.2
Potri.012G106500.1
Prunus persicappa000458mppa021513mppa000707mppa000755mppa000717m
Ricinus communis29822.m00342029868.m00034130131.m00698230131.m00698130147.m014412
Setaria italicaSi005719mSi038673mSi025964mSi034056mSi025881m
Selaginella moellendorffii104910154366266756410022178241
Sorghum bicolorSb10g008770.1Sb01g026405.1Sb05g019600.1Sb01g026390.1
Thellungiella halophilaThhalv10012487mThhalv10012612mThhalv10012546mThhalv10003575mThhalv10003577m
Vitis viniferaGSVIVT01032586001GSVIVT01018752001GSVIVT01032988001GSVIVT01008340001GSVIVT01008642001
GSVIVT01032989001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)