y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.004G049200.1
FamilyGH81
Protein PropertiesLength: 663 Molecular Weight: 73581.8 Isoelectric Point: 5.5618
ChromosomeChromosome/Scaffold: 04 Start: 5742762 End: 5745170
Descriptionglycosyl hydrolase family 81 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH81176550
  TVLPDPSNFFSSTLLSKPLPTNSFFQNFVLKNGDQPEYIHPYLIKSSNSSLSLSYPSRQVNSAFIYQVFNADLTISSKQGSSGKHLISSYSDLSVTLDIP
  SSNLSFLLVRGSPFLTVSVTQPTPLSITTIHAILSFSSNKTNTKHTFHFNNGQTWILYASSTIKLSHTLSEITSDAFSGIVRIALLPDSDSKHEAVLDKF
  SSCYPVSGEAIFREPFCVEYKWEKKGSGDLLLLAHPLHVQLLSNGDNDVTVLEDFKYGSIDGDVVGVVGDSWVLQTDPVYVTWHSTKGVKEESHDEIVSA
  LSNDVEGLNSSSISTTSSYFYGKLIARAARLALIAEELSYPDVIPKVKKFLKESIEPWLEGTFNGNGFLHDKKWGGIITQQGSNDGGGDFGFGIYNDHHY
  HLGYFLYAIAVLVKLDPAWGRKYKAQAYSIVQDFMNLDTKLNSNYTRLRNFDLYVLHSWAGGLTEFSDGRNQESTSEAVCAYYSAALVGLAYGDARLVSL
  GSTLTALEILGTKMWWHVEEGGSLYEEEFTRENRIMGVLWSNKRDSGLWFAPAEWKECRLGIQLLPLAPISEAIFSNAEYVKQLVEWTLPALNRDGVGEG
  WKGFVYALEGIYDNESALQKIRNLAGFDGGNSLSNLLWW
Full Sequence
Protein Sequence     Length: 663     Download
MAKQNKTHFI FPETQSTVLP DPSNFFSSTL LSKPLPTNSF FQNFVLKNGD QPEYIHPYLI    60
KSSNSSLSLS YPSRQVNSAF IYQVFNADLT ISSKQGSSGK HLISSYSDLS VTLDIPSSNL    120
SFLLVRGSPF LTVSVTQPTP LSITTIHAIL SFSSNKTNTK HTFHFNNGQT WILYASSTIK    180
LSHTLSEITS DAFSGIVRIA LLPDSDSKHE AVLDKFSSCY PVSGEAIFRE PFCVEYKWEK    240
KGSGDLLLLA HPLHVQLLSN GDNDVTVLED FKYGSIDGDV VGVVGDSWVL QTDPVYVTWH    300
STKGVKEESH DEIVSALSND VEGLNSSSIS TTSSYFYGKL IARAARLALI AEELSYPDVI    360
PKVKKFLKES IEPWLEGTFN GNGFLHDKKW GGIITQQGSN DGGGDFGFGI YNDHHYHLGY    420
FLYAIAVLVK LDPAWGRKYK AQAYSIVQDF MNLDTKLNSN YTRLRNFDLY VLHSWAGGLT    480
EFSDGRNQES TSEAVCAYYS AALVGLAYGD ARLVSLGSTL TALEILGTKM WWHVEEGGSL    540
YEEEFTRENR IMGVLWSNKR DSGLWFAPAE WKECRLGIQL LPLAPISEAI FSNAEYVKQL    600
VEWTLPALNR DGVGEGWKGF VYALEGIYDN ESALQKIRNL AGFDGGNSLS NLLWWIHSIG    660
NE*                                                                  720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5498ACF23.0e-911223243+
COG5498ACF24.0e-36386658280+
pfam03639Glyco_hydro_815.0e-17511655696+
Gene Ontology
GO TermDescription
GO:0016998cell wall macromolecule catabolic process
GO:0033903endo-1,3(4)-beta-glucanase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAF19265.1016621662AF088188_1 beta-glucan binding protein [Phaseolus vulgaris]
GenBankABB69781.10966011669beta-glucan-binding protein 1 [Medicago truncatula]
GenBankABB69784.10966211668beta-glucan-binding protein 4 [Medicago truncatula]
DDBJBAA11407.1046625668beta-glucan-elicitor receptor [Glycine max]
EMBLCAA71307.1046625668beta-glucan binding protein [Glycine max]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FE6916582284366630
FE6916592284366630
FE6916652652695330
FE6916602124526630
FE691660194334510.029
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01041.1
Arabidopsis lyrata909564
Arabidopsis thalianaAT5G15870.1AT1G18310.1
Brachypodium distachyonBradi4g29390.1
Brassica rapaBra023544Bra008667Bra025916
Carica papayaevm.TU.contig_34602.1evm.model.supercontig_179.46
Capsella rubellaCarubv10000292mCarubv10008525m
Chlamydomonas reinhardtiiCre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714
Citrus clementinaCiclev10011145m
Citrus sinensisorange1.1g042050m
Cucumis sativusCucsa.238220.1Cucsa.238230.1Cucsa.237660.1
Eucalyptus grandisEucgr.I02120.1Eucgr.I02118.1Eucgr.I02113.1Eucgr.L01291.1Eucgr.I02117.1
Eucgr.L01293.1Eucgr.L01292.1Eucgr.L01830.1Eucgr.L01010.1Eucgr.L01290.1
Eucgr.I02115.1Eucgr.I02114.1
Fragaria vescamrna10352.1-v1.0-hybridmrna04398.1-v1.0-hybridmrna25909.1-v1.0-hybridmrna04399.1-v1.0-hybridmrna24770.1-v1.0-hybrid
Glycine maxGlyma19g05550.2Glyma13g07230.2Glyma18g50180.1Glyma18g50220.1Glyma08g26935.1
Glyma13g07220.1Glyma08g27000.1Glyma08g26940.1Glyma08g26980.1Glyma13g07240.2
Glyma13g07210.2.390.614Glyma13g07210.2.390.614Glyma03g04290.1Glyma13g07210.2.22.372Glyma13g07210.2.22.372
Gossypium raimondiiGorai.001G082200.1Gorai.007G368000.1
Linum usitatissimumLus10021987Lus10042525Lus10042526
Malus domesticaMDP0000148377MDP0000314562MDP0000855663MDP0000695045MDP0000199068
MDP0000517518MDP0000206670
Manihot esculentacassava4.1_002382m
Medicago truncatulaAC233685_94.1AC233572_18.1AC233685_92.1AC233572_20.1Medtr7g013170.1
AC233572_21.1AC233572_19.1AC233572_25.1AC233685_93.1AC233572_23.1
AC233572_30.1AC233685_76.1AC233572_29.1AC233685_33.1AC233685_46.1
AC233685_68.1AC233685_75.1AC233685_34.1AC233685_74.1Medtr1g079270.1
Medtr7g112730.1
Mimulus guttatusmgv1a002257m
Oryza sativaLOC_Os09g21210.1
Panicum virgatumPavirv00025146mPavirv00045049mPavirv00057587mPavirv00052228m
Physcomitrella patensPp1s16_374V6.1
Phaseolus vulgarisPhvul.004G049300.1Phvul.008G033100.1Phvul.008G033200.1Phvul.008G033000.1Phvul.004G049400.1
Picea abiesMA_10050955g0010MA_28794g0010MA_18557g0010MA_10435904g0010MA_17399g0010
Populus trichocarpaPotri.004G105300.1
Prunus persicappa001976mppa019057mppa023327mppa025396mppa022822m
ppa018031m
Ricinus communis27469.m00016529980.m00017535080.m000014
Setaria italicaSi029037m
Selaginella moellendorffii10094297501
Sorghum bicolorSb02g023660.1Sb10g001930.1
Thellungiella halophilaThhalv10012764mThhalv10003773m
Vitis viniferaGSVIVT01036466001
Volvox carteriVocar20013899m.72.571Vocar20013899m.72.571
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)