y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.004G049400.1
FamilyGH81
Protein PropertiesLength: 744 Molecular Weight: 82698 Isoelectric Point: 6.9089
ChromosomeChromosome/Scaffold: 04 Start: 5766663 End: 5769222
Descriptionglycosyl hydrolase family 81 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH81777190
  LPDPSTFFAPNLLSSPLPTNSFFQNYVLQNGDTPEYIHPYLIKSSNSSLSLSYPSLNFNSSFIAQVFNPDITISSTESKTTPGLHARHVISSFSDLSLTL
  DIPSSNLRFFLVRGSPFVTASVTCPTPLSITTMHAILSLSSNNSLTKHTLQLNNGQSWLINTSSPISLNHSLSEITSGEFSGIIRIAVLPDSDPKYEAIL
  NRFSSCYPVSGDATFTNPFCVKYKWEKKGWGELLMLAHPLHLQLLNDGGDSGVTVLHNLKFRSIDGELVGVVGDSWLLKTDPVSVTWHSTRGIKEEFHEE
  IFSVLSEDVEALNPLGITTTSCYFYGKIVARAARLALIAEEVAFLDAMPVIRKFLKEIIEPWLDGTFSGNGFLYEGKWGGIVTKQGSKDSGADFGFGVYN
  DHHYNLGYFLYGIAVLAKIDPAWGRKYKPQAYSLVADFMSLGRRSDSKYTRLRCFDLYKLHSWAGGLTEFEDGRNQESTSEAVNAYYSAALMGLAYGDTQ
  LIATGSTLAALEIHAAQMWWHLGEGHKLYEEDFTKENKVVSVVWANKRDSGLWFAPSQWRECRLGIHVLPLSPITEALFSDVGYVKELVEWTVPNLNRKC
  VGEGWKGFIYALEGTYDKESALQKVRSLKVFDDGNSVSNLLWW
Full Sequence
Protein Sequence     Length: 744     Download
MFKKLGRKIE REITKPFKNK PRPRPTFPPP PPPPPPPPPL PSSTPPPPPP PPSPPPPPLP    60
KQPNAPFLFP QAHSTILPDP STFFAPNLLS SPLPTNSFFQ NYVLQNGDTP EYIHPYLIKS    120
SNSSLSLSYP SLNFNSSFIA QVFNPDITIS STESKTTPGL HARHVISSFS DLSLTLDIPS    180
SNLRFFLVRG SPFVTASVTC PTPLSITTMH AILSLSSNNS LTKHTLQLNN GQSWLINTSS    240
PISLNHSLSE ITSGEFSGII RIAVLPDSDP KYEAILNRFS SCYPVSGDAT FTNPFCVKYK    300
WEKKGWGELL MLAHPLHLQL LNDGGDSGVT VLHNLKFRSI DGELVGVVGD SWLLKTDPVS    360
VTWHSTRGIK EEFHEEIFSV LSEDVEALNP LGITTTSCYF YGKIVARAAR LALIAEEVAF    420
LDAMPVIRKF LKEIIEPWLD GTFSGNGFLY EGKWGGIVTK QGSKDSGADF GFGVYNDHHY    480
NLGYFLYGIA VLAKIDPAWG RKYKPQAYSL VADFMSLGRR SDSKYTRLRC FDLYKLHSWA    540
GGLTEFEDGR NQESTSEAVN AYYSAALMGL AYGDTQLIAT GSTLAALEIH AAQMWWHLGE    600
GHKLYEEDFT KENKVVSVVW ANKRDSGLWF APSQWRECRL GIHVLPLSPI TEALFSDVGY    660
VKELVEWTVP NLNRKCVGEG WKGFIYALEG TYDKESALQK VRSLKVFDDG NSVSNLLWWI    720
HSRGDVEEEF GQGKQCWFGH YCH*                                           780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5498ACF23.0e-4990722692+
pfam03639Glyco_hydro_81074723695+
Gene Ontology
GO TermDescription
GO:0016998cell wall macromolecule catabolic process
GO:0033903endo-1,3(4)-beta-glucanase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABB69784.10627436685beta-glucan-binding protein 4 [Medicago truncatula]
GenBankABB69785.101557432590beta-glucan-binding protein 5 [Medicago truncatula]
DDBJBAA11407.10627255667beta-glucan-elicitor receptor [Glycine max]
RefSeqXP_002282971.1017431744PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002305966.10617438690predicted protein [Populus trichocarpa]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES8165422913506400
GR9996172644276900
FE6916562564897440
FE6916632753586320
JG6583242684487150
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01041.1
Arabidopsis lyrata909564
Arabidopsis thalianaAT5G15870.1AT1G18310.1
Brachypodium distachyonBradi4g29390.1
Brassica rapaBra023544Bra008667Bra025916
Carica papayaevm.TU.contig_34602.1evm.model.supercontig_179.46
Capsella rubellaCarubv10000292mCarubv10008525m
Chlamydomonas reinhardtiiCre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714
Citrus clementinaCiclev10011145m
Citrus sinensisorange1.1g042050m
Cucumis sativusCucsa.238220.1Cucsa.238230.1Cucsa.237660.1
Eucalyptus grandisEucgr.I02120.1Eucgr.I02118.1Eucgr.I02113.1Eucgr.L01291.1Eucgr.I02117.1
Eucgr.L01293.1Eucgr.L01292.1Eucgr.L01830.1Eucgr.L01010.1Eucgr.L01290.1
Eucgr.I02115.1Eucgr.I02114.1
Fragaria vescamrna10352.1-v1.0-hybridmrna04398.1-v1.0-hybridmrna25909.1-v1.0-hybridmrna04399.1-v1.0-hybridmrna24770.1-v1.0-hybrid
Glycine maxGlyma19g05550.2Glyma13g07230.2Glyma18g50180.1Glyma18g50220.1Glyma08g26935.1
Glyma13g07220.1Glyma08g27000.1Glyma08g26940.1Glyma08g26980.1Glyma13g07240.2
Glyma13g07210.2.390.614Glyma13g07210.2.390.614Glyma03g04290.1Glyma13g07210.2.22.372Glyma13g07210.2.22.372
Gossypium raimondiiGorai.001G082200.1Gorai.007G368000.1
Linum usitatissimumLus10021987Lus10042525Lus10042526
Malus domesticaMDP0000148377MDP0000314562MDP0000855663MDP0000695045MDP0000199068
MDP0000517518MDP0000206670
Manihot esculentacassava4.1_002382m
Medicago truncatulaAC233685_94.1AC233572_18.1AC233685_92.1AC233572_20.1Medtr7g013170.1
AC233572_21.1AC233572_19.1AC233572_25.1AC233685_93.1AC233572_23.1
AC233572_30.1AC233685_76.1AC233572_29.1AC233685_33.1AC233685_46.1
AC233685_68.1AC233685_75.1AC233685_34.1AC233685_74.1Medtr1g079270.1
Medtr7g112730.1
Mimulus guttatusmgv1a002257m
Oryza sativaLOC_Os09g21210.1
Panicum virgatumPavirv00025146mPavirv00045049mPavirv00057587mPavirv00052228m
Physcomitrella patensPp1s16_374V6.1
Phaseolus vulgarisPhvul.004G049300.1Phvul.008G033100.1Phvul.008G033200.1Phvul.008G033000.1Phvul.004G049200.1
Picea abiesMA_10050955g0010MA_28794g0010MA_18557g0010MA_10435904g0010MA_17399g0010
Populus trichocarpaPotri.004G105300.1
Prunus persicappa001976mppa019057mppa023327mppa025396mppa022822m
ppa018031m
Ricinus communis27469.m00016529980.m00017535080.m000014
Setaria italicaSi029037m
Selaginella moellendorffii10094297501
Sorghum bicolorSb02g023660.1Sb10g001930.1
Thellungiella halophilaThhalv10012764mThhalv10003773m
Vitis viniferaGSVIVT01036466001
Volvox carteriVocar20013899m.72.571Vocar20013899m.72.571
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)