y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.004G064500.1
FamilyGT57
Protein PropertiesLength: 515 Molecular Weight: 58785.3 Isoelectric Point: 9.0366
ChromosomeChromosome/Scaffold: 04 Start: 8967206 End: 8972005
DescriptionALG6, ALG8 glycosyltransferase family
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT57374930
  LLVRVAVSLHPYSGAANPPKFGDYEAQRHWMEITTNLPIKEWYRNSSTNDLSYWGLDYPPFTAYQSFIHGHLLRFFHPHSVALLTSRGHESYLGKLLMRW
  TVLSSDALIFFPAVLYFLFVHYNKPSKSRKSELVWHTAALLLSPCLILIDHGHFQFNCISLGFTIGAVAAILSGKDFVGSVLYCLALNHKQMSAYFAPAF
  FSHLLGKCLRRKHPILEVLKLGLLVLGTFAAVWWPYLYSTQSVLEVLSRLAPFERGIFEDYVANFWCASSVLIKWKRLFTKESLKLISFTATVITCLPSM
  IQQIKSPSYRGFLYALLNSSFSFYLFSFQVHEKSILLPILPATLLAVDEPFIFKWFTQFAMLSMFPLICRDNLVVAYLALLAVFVVILNAPVQHRVRETN
  YLNSSWGSATMFFILCCYFVLHIFYLTMHPPEKYPFLFEAIIMNLCFSQFVLVTLAC
Full Sequence
Protein Sequence     Length: 515     Download
MKKGKKVKES GSDDDCDCWL VQNGIAGVFM SVGLFALLVR VAVSLHPYSG AANPPKFGDY    60
EAQRHWMEIT TNLPIKEWYR NSSTNDLSYW GLDYPPFTAY QSFIHGHLLR FFHPHSVALL    120
TSRGHESYLG KLLMRWTVLS SDALIFFPAV LYFLFVHYNK PSKSRKSELV WHTAALLLSP    180
CLILIDHGHF QFNCISLGFT IGAVAAILSG KDFVGSVLYC LALNHKQMSA YFAPAFFSHL    240
LGKCLRRKHP ILEVLKLGLL VLGTFAAVWW PYLYSTQSVL EVLSRLAPFE RGIFEDYVAN    300
FWCASSVLIK WKRLFTKESL KLISFTATVI TCLPSMIQQI KSPSYRGFLY ALLNSSFSFY    360
LFSFQVHEKS ILLPILPATL LAVDEPFIFK WFTQFAMLSM FPLICRDNLV VAYLALLAVF    420
VVILNAPVQH RVRETNYLNS SWGSATMFFI LCCYFVLHIF YLTMHPPEKY PFLFEAIIMN    480
LCFSQFVLVT LACNIKQWLS NKPAKLEEIE KKLI*                               540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03155Alg6_Alg82.0e-9536486462+
Gene Ontology
GO TermDescription
GO:0005789endoplasmic reticulum membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001145139.1015131519hypothetical protein LOC100278369 [Zea mays]
RefSeqNP_198662.1015141533ALG6, ALG8 glycosyltransferase family protein [Arabidopsis thaliana]
RefSeqXP_002280181.1045146516PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002305159.104051315490predicted protein [Populus trichocarpa]
RefSeqXP_002329281.104051311485predicted protein [Populus trichocarpa]
Transmembrane Domains
StartEnd
2143
134156
169191
201223
251273
347364
371389
409428
441463
473495
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FC45742624712450
FS33072725022510
DT55953427792840
EB68010225222500
FS07598324322440
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00849.3Aquca_007_00849.4Aquca_007_00849.2Aquca_007_00849.1
Arabidopsis lyrata494131
Arabidopsis thalianaAT5G38460.2AT5G38460.1
Brachypodium distachyonBradi1g63540.1
Brassica rapaBra028183
Capsella rubellaCarubv10004565m
Chlamydomonas reinhardtiiCre16.g690150.t1.2.24.157Cre16.g690150.t1.2.206.572Cre16.g690150.t1.2.24.157Cre16.g690150.t1.2.206.572
Citrus clementinaCiclev10011466mCiclev10011636mCiclev10012149m
Citrus sinensisorange1.1g021456m
Cucumis sativusCucsa.031380.1
Eucalyptus grandisEucgr.F02485.1Eucgr.F02485.2.50.327Eucgr.F02485.2.50.327Eucgr.F02485.2.327.474Eucgr.F02485.2.327.474
Fragaria vescamrna11817.1-v1.0-hybrid
Glycine maxGlyma13g07560.1
Gossypium raimondiiGorai.006G229700.2Gorai.006G229700.1
Linum usitatissimumLus10017594Lus10033554
Malus domesticaMDP0000909996MDP0000278459MDP0000180745MDP0000308736
Manihot esculentacassava4.1_009619mcassava4.1_005541m
Mimulus guttatusmgv1a004432m
Oryza sativaLOC_Os07g07010.1
Panicum virgatumPavirv00049296mPavirv00013587mPavirv00013588m
Physcomitrella patensPp1s290_38V6.3Pp1s290_38V6.2Pp1s290_38V6.1
Phaseolus vulgarisPhvul.002G243400.1Phvul.002G243400.2
Picea abiesMA_111087g0010
Populus trichocarpaPotri.017G114100.2Potri.004G100500.1Potri.017G114100.1
Prunus persicappa004184m
Ricinus communis30205.m001578
Setaria italicaSi036186mSi035197m
Selaginella moellendorffii114109
Sorghum bicolorSb01g036460.2.41.351Sb01g036460.2.41.351Sb01g036460.1Sb01g036460.2.352.477Sb01g036460.2.352.477
Thellungiella halophilaThhalv10017711mThhalv10027717m
Vitis viniferaGSVIVT01031043001
Volvox carteriVocar20001407m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny