y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.004G101600.1
FamilyPL1
Protein PropertiesLength: 374 Molecular Weight: 42255.4 Isoelectric Point: 10.2864
ChromosomeChromosome/Scaffold: 04 Start: 30122338 End: 30123782
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL1922920
  VWITFQKDMLITLEKPLLISSFTTIDGRGVNVQIANNACLMIFKATNIIIHGIRVHHCKPQAPGIVMGPEGKVIPLGHVDGDAIRLVTASKIWIDHNTFY
  NCQDGLLDVTRGSTNVTISNNWFKNQDKVMLLGHDDGYVRDQNMKVTVVYNHFGPNCNQRMPRIRHGYAHVANNLYQGWLQYAIGGSMEPSLKSEANLFI
  A
Full Sequence
Protein Sequence     Length: 374     Download
MILFFISSIS FAKQSKINGW KMNVIDRCWR LNSEWRRHQS QLATCSVGYA GKMVNNIGKD    60
IIHYKVTDSS DDPINPKPNT LRYGTSIIQG KVWITFQKDM LITLEKPLLI SSFTTIDGRG    120
VNVQIANNAC LMIFKATNII IHGIRVHHCK PQAPGIVMGP EGKVIPLGHV DGDAIRLVTA    180
SKIWIDHNTF YNCQDGLLDV TRGSTNVTIS NNWFKNQDKV MLLGHDDGYV RDQNMKVTVV    240
YNHFGPNCNQ RMPRIRHGYA HVANNLYQGW LQYAIGGSME PSLKSEANLF IAPTIGNKEV    300
TWRKSSNKNG DRWNFHSIGD NFENGASFAV TKGRDMQKPN YSKEQKFKVV NAKFVRSLTR    360
SSGVLRYNRN FVN*                                                      420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00295Glyco_hydro_280.00280218145+
COG3866PelB2.0e-2788290215+
pfam00544Pec_lyase_C4.0e-52112290187+
smart00656Amb_all4.0e-6399293206+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI26401.10533661313unnamed protein product [Vitis vinifera]
RefSeqXP_002267384.102236619362PREDICTED: similar to putative Cup s 1 pollen allergen [Vitis vinifera]
RefSeqXP_002299118.10223721353predicted protein [Populus trichocarpa]
RefSeqXP_002304865.10223691348predicted protein [Populus trichocarpa]
RefSeqXP_002527354.10130015307Major pollen allergen Jun v 1 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B0233652345A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A0233652345A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB3zsc_A1e-178228140227A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB1vbl_A0.00000000000000197290122330A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB3vmw_A0.000000000000311529082246A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT5757502231443660
FD7579992241063290
DR808308255232700
EL457563284233030
EL457552274232940
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00024.1Aquca_018_00074.1Aquca_015_00229.1
Arabidopsis lyrata487738881338
Arabidopsis thalianaAT5G09280.1AT1G30350.1
Brassica rapaBra009375Bra012756
Carica papayaevm.model.supercontig_42.185evm.model.supercontig_51.17
Capsella rubellaCarubv10002943mCarubv10006459m
Citrus sinensisorange1.1g041616m
Cucumis sativusCucsa.112490.1
Eucalyptus grandisEucgr.K02336.1
Fragaria vescamrna29291.1-v1.0-hybrid
Glycine maxGlyma11g06761.1Glyma01g38540.1Glyma16g25710.2Glyma13g21880.2
Gossypium raimondiiGorai.010G196700.1Gorai.010G196900.1Gorai.010G197000.1Gorai.010G197100.1Gorai.010G197400.1
Gorai.008G271800.1Gorai.008G271900.1Gorai.010G197600.1Gorai.010G197500.1Gorai.004G231500.1
Gorai.010G196800.1Gorai.010G197300.1
Linum usitatissimumLus10031867Lus10031296
Malus domesticaMDP0000244018MDP0000233331MDP0000166129
Manihot esculentacassava4.1_026008mcassava4.1_024289mcassava4.1_025601mcassava4.1_023158m
Medicago truncatulaMedtr6g077900.1Medtr8g078350.1Medtr5g035840.1Medtr5g019060.1Medtr4g064420.1
Medtr3g030900.1Medtr8g078310.1Medtr8g078390.1Medtr8g078280.1Medtr5g019090.1
Medtr5g019170.1Medtr5g019160.1
Mimulus guttatusmgv1a021987m
Oryza sativaLOC_Os08g18970.1
Panicum virgatumPavirv00017566m
Physcomitrella patensPp1s385_14V6.1Pp1s45_65V6.1
Phaseolus vulgarisPhvul.004G101900.1Phvul.002G025800.1Phvul.004G098100.1
Picea abiesMA_10433764g0010
Populus trichocarpaPotri.003G218200.1Potri.001G007400.1Potri.003G218200.2Potri.005G064500.2Potri.005G064500.1
Prunus persicappa016145mppa021860mppa016917mppa025917mppa016255m
Ricinus communis29596.m00070329743.m000300
Setaria italicaSi013945m
Selaginella moellendorffii88799
Sorghum bicolorSb03g036930.1
Thellungiella halophilaThhalv10015832m
Vitis viniferaGSVIVT01024239001
Zea maysAC233851.1_FGT011
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny