y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.004G101900.1
FamilyPL1
Protein PropertiesLength: 237 Molecular Weight: 27593 Isoelectric Point: 8.6859
ChromosomeChromosome/Scaffold: 04 Start: 30456030 End: 30458170
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL1491552.5e-24
  SDDPITQTKHLKIDHNTLYDCQDGLFDVTRGSTDVTISNNWFKNQDKVMLLGHDDRYVRDETMKVTVVYNHFEPNCNQSNFYQGWLQYGIGRSMERSLKS
  EANPFVA
Full Sequence
Protein Sequence     Length: 237     Download
MNVIDRCWGQ NPEWWRHQSQ LAISFVTCAC KMINNIGNDL IHYKVSHSSD DPITQTKHLK    60
IDHNTLYDCQ DGLFDVTRGS TDVTISNNWF KNQDKVMLLG HDDRYVRDET MKVTVVYNHF    120
EPNCNQSNFY QGWLQYGIGR SMERSLKSEA NPFVAPTIGN KEVTWRKGND KNEDKWKFHS    180
IRDVFENGPY FNVTKGGDVK KLNDSKERNF KVVDAKFVRF ITHSSGVLRY NKHSIY*       240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3866PelB2.0e-1249153132+
pfam00544Pec_lyase_C1.0e-2053153122+
smart00656Amb_all5.0e-2553156126+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI26401.102823497318unnamed protein product [Vitis vinifera]
RefSeqXP_002267384.10.000000061531971PREDICTED: similar to putative Cup s 1 pollen allergen [Vitis vinifera]
RefSeqXP_002267384.1028234146367PREDICTED: similar to putative Cup s 1 pollen allergen [Vitis vinifera]
RefSeqXP_002304865.10.000000009153153predicted protein [Populus trichocarpa]
RefSeqXP_002304865.1036234137350predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B5e-3361228163345A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A5e-3361228163345A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB3zsc_A0.00024118998300A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT575750182612290
FG478648200492340
FG474249196532340
FG470156172441990
FG468635172441990
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00024.1Aquca_018_00074.1Aquca_015_00229.1
Arabidopsis lyrata487738881338
Arabidopsis thalianaAT5G09280.1AT1G30350.1
Brassica rapaBra009375Bra012756
Carica papayaevm.model.supercontig_42.185evm.model.supercontig_51.17
Capsella rubellaCarubv10002943mCarubv10006459m
Citrus sinensisorange1.1g041616m
Cucumis sativusCucsa.112490.1
Eucalyptus grandisEucgr.K02336.1
Fragaria vescamrna29291.1-v1.0-hybrid
Glycine maxGlyma11g06761.1Glyma01g38540.1Glyma16g25710.2Glyma13g21880.2
Gossypium raimondiiGorai.010G196700.1Gorai.010G196900.1Gorai.010G197000.1Gorai.010G197100.1Gorai.010G197400.1
Gorai.008G271800.1Gorai.008G271900.1Gorai.010G197600.1Gorai.010G197500.1Gorai.004G231500.1
Gorai.010G196800.1Gorai.010G197300.1
Linum usitatissimumLus10031867Lus10031296
Malus domesticaMDP0000244018MDP0000233331MDP0000166129
Manihot esculentacassava4.1_026008mcassava4.1_024289mcassava4.1_025601mcassava4.1_023158m
Medicago truncatulaMedtr6g077900.1Medtr8g078350.1Medtr5g035840.1Medtr5g019060.1Medtr4g064420.1
Medtr3g030900.1Medtr8g078310.1Medtr8g078390.1Medtr8g078280.1Medtr5g019090.1
Medtr5g019170.1Medtr5g019160.1
Mimulus guttatusmgv1a021987m
Oryza sativaLOC_Os08g18970.1
Panicum virgatumPavirv00017566m
Physcomitrella patensPp1s385_14V6.1Pp1s45_65V6.1
Phaseolus vulgarisPhvul.002G025800.1Phvul.004G098100.1Phvul.004G101600.1
Picea abiesMA_10433764g0010
Populus trichocarpaPotri.003G218200.1Potri.001G007400.1Potri.003G218200.2Potri.005G064500.2Potri.005G064500.1
Prunus persicappa016145mppa021860mppa016917mppa025917mppa016255m
Ricinus communis29596.m00070329743.m000300
Setaria italicaSi013945m
Selaginella moellendorffii88799
Sorghum bicolorSb03g036930.1
Thellungiella halophilaThhalv10015832m
Vitis viniferaGSVIVT01024239001
Zea maysAC233851.1_FGT011
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny