y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.004G139400.1
FamilyGT66
Protein PropertiesLength: 724 Molecular Weight: 81348.8 Isoelectric Point: 9.3167
ChromosomeChromosome/Scaffold: 04 Start: 41811712 End: 41817659
Descriptionstaurosporin and temperature sensitive 3-like b
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT66286720
  LIRVATLALIYILAFITRLFSVLRYESMIHEFDPYFNYRTTLFLTRNGFAEFWNWFDSESWYPLGRIIGGTLYPGLMLTAAAIHSLLRFLRLFVHIREVC
  VLTAPFFASNTTLVAYFFAKEVWDSGAGIVAAALIAICPGYISRSVAGSYDNEGVAIFALLLTFYLFVKAVNTGSLAWALGSAFGYFYMVSAWGGYVFII
  NLVPLYVLVLLVTGRYSLRLYVAYNCMYVLGMLLAMQIRFVGFQHVQSGEHMAAMGVFFLLQVFFFLDWVRHLLSDTKLFQAFLKITVTTAVTVGAVALG
  LGMASGYISPWTGRFYSLLDPTYAKDHIPIIASVSEHQPTAWSSFMFDFHILLFLFPAGLYFCFKRLSDATIFLVMYGLTSMYFAGVMVRLILVATPAVC
  LISAIAVSATVKNLTRVVRAKSPAVQSGSTKGTSSAKGSSKGVIDNSQPFQRNGAIVLLLGAFYLLSRYAIHCTWVTSEAYSSPSIVLAARGAHGQRVIF
  DDYREAYFWLRQNTPPDAKVMSWWDYGYQITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSSDDINKFLWMVRI
  GGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGEL
Full Sequence
Protein Sequence     Length: 724     Download
MAQDLKPSIS SFSLPKTLKL KTKQQELLIR VATLALIYIL AFITRLFSVL RYESMIHEFD    60
PYFNYRTTLF LTRNGFAEFW NWFDSESWYP LGRIIGGTLY PGLMLTAAAI HSLLRFLRLF    120
VHIREVCVLT APFFASNTTL VAYFFAKEVW DSGAGIVAAA LIAICPGYIS RSVAGSYDNE    180
GVAIFALLLT FYLFVKAVNT GSLAWALGSA FGYFYMVSAW GGYVFIINLV PLYVLVLLVT    240
GRYSLRLYVA YNCMYVLGML LAMQIRFVGF QHVQSGEHMA AMGVFFLLQV FFFLDWVRHL    300
LSDTKLFQAF LKITVTTAVT VGAVALGLGM ASGYISPWTG RFYSLLDPTY AKDHIPIIAS    360
VSEHQPTAWS SFMFDFHILL FLFPAGLYFC FKRLSDATIF LVMYGLTSMY FAGVMVRLIL    420
VATPAVCLIS AIAVSATVKN LTRVVRAKSP AVQSGSTKGT SSAKGSSKGV IDNSQPFQRN    480
GAIVLLLGAF YLLSRYAIHC TWVTSEAYSS PSIVLAARGA HGQRVIFDDY REAYFWLRQN    540
TPPDAKVMSW WDYGYQITAM GNRTVIVDNN TWNNTHIATV GRAMSSYEDE AYEIMRSLDV    600
DYVLVVFGGV TGYSSDDINK FLWMVRIGGG VFPVIKEPDY LVNGEYRVDK GAAPKMLNCL    660
MYKLSYYRFG ELTTEYGRPP GYDRARGVEI GNKDIKLEYL EEALTTQNWI VRIYKVKPPK    720
NRW*                                                                 780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR04154archaeo_STT37.0e-7356605284+
TIGR04154archaeo_STT31.0e-1134227218+
COG1287COG12876.0e-5729721730+
pfam02516STT36.0e-12929674662+
Gene Ontology
GO TermDescription
GO:0004576oligosaccharyl transferase activity
GO:0006486protein glycosylation
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_174675.20672216734STT3B (staurosporin and temperature sensitive 3-like b); oligosaccharyl transferase [Arabidopsis thaliana]
RefSeqXP_002269119.10572323737PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002318345.102472322721predicted protein [Populus trichocarpa]
RefSeqXP_002329687.10972325721predicted protein [Populus trichocarpa]
RefSeqXP_002448765.10137228719hypothetical protein SORBIDRAFT_06g032800 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2lgz_A049971720238A Chain A, Solution Structure Of Stt3p
PDB3vu0_C0.0000035296456123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_B0.0000035296456123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_A0.0000035296456123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vgp_A0.000045286296113A Chain A, Crystal Structure Of The C-Terminal Globular Domain Of Oligosaccharyltransferase (Af_0329) From Archaeoglobus Fulgidus
Transmembrane Domains
StartEnd
2749
92114
121143
153175
182204
219241
248270
280302
309331
369391
398420
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8701293234007220
GT0360633472986440
GT0332323193406580
GO8695183263736980
GO869518196897073.1
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01458.1Aquca_001_00320.1
Arabidopsis lyrata891007488863
Arabidopsis thalianaAT1G34130.1AT5G19690.1
Brachypodium distachyonBradi5g26030.1Bradi2g49640.1Bradi2g19510.1
Brassica rapaBra028034Bra006514Bra002255Bra034441
Carica papayaevm.model.supercontig_467.1.248.439evm.model.supercontig_467.1.248.439evm.model.supercontig_40.47
Capsella rubellaCarubv10008402mCarubv10000271m
Chlamydomonas reinhardtiiCre07.g330100.t1.2g9581.t1
Citrus clementinaCiclev10019005mCiclev10019106mCiclev10007574mCiclev10007513mCiclev10007684m
Citrus sinensisorange1.1g004635morange1.1g005395morange1.1g004678morange1.1g003973m
Cucumis sativusCucsa.122250.1Cucsa.122250.2Cucsa.329260.1Cucsa.329260.2
Eucalyptus grandisEucgr.K02314.1Eucgr.C01008.1
Fragaria vescamrna09173.1-v1.0-hybridmrna11885.1-v1.0-hybrid
Glycine maxGlyma16g33881.1Glyma09g29470.1Glyma01g01270.1Glyma16g08410.1
Gossypium raimondiiGorai.013G004300.1Gorai.013G004300.2Gorai.011G219600.1Gorai.011G219600.4Gorai.011G219600.3
Gorai.011G219600.2Gorai.011G219600.5Gorai.013G229700.1Gorai.010G075800.1Gorai.010G075800.2
Gorai.010G075800.3
Linum usitatissimumLus10041985Lus10017990Lus10043241Lus10011124
Malus domesticaMDP0000299027MDP0000589608MDP0000158858MDP0000201702MDP0000300736
Manihot esculentacassava4.1_002347mcassava4.1_021540m
Medicago truncatulaMedtr6g077750.1Medtr6g077750.2Medtr1g114250.1
Mimulus guttatusmgv1a001976mmgv1a001650m
Oryza sativaLOC_Os04g57890.1LOC_Os05g44360.1LOC_Os05g44360.2
Panicum virgatumPavirv00017930mPavirv00007453mPavirv00022940mPavirv00024588mPavirv00056880m
Pavirv00065583m
Physcomitrella patensPp1s98_21V6.1Pp1s404_37V6.1Pp1s404_38V6.1
Phaseolus vulgarisPhvul.004G170000.1
Picea abiesMA_174842g0010MA_10216317g0010MA_5501292g0010MA_10436134g0010
Populus trichocarpaPotri.012G036300.1Potri.015G028300.1Potri.015G028300.2Potri.018G086000.2Potri.018G086000.1
Potri.006G163600.1
Prunus persicappa001886mppa001464m
Ricinus communis30189.m00167429912.m005461
Setaria italicaSi021341mSi000402mSi021271mSi021321m
Selaginella moellendorffii110405118919
Sorghum bicolorSb06g032800.1Sb09g025920.1Sb03g034385.1
Thellungiella halophilaThhalv10006908mThhalv10012742m
Vitis viniferaGSVIVT01015322001GSVIVT01029339001
Volvox carteriVocar20013212mVocar20003562m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)