y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.004G170000.1
FamilyGT66
Protein PropertiesLength: 775 Molecular Weight: 86206.4 Isoelectric Point: 9.4981
ChromosomeChromosome/Scaffold: 04 Start: 45162279 End: 45171267
Descriptionstaurosporin and temperature sensitive 3-like A
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT66217260
  LAFFILLLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCV
  FTAPIFSAFASWATYLLTKEVKGAGAGLTAAILLAMVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNSIAYFYMVCSWGGYTFIIN
  LIPMHVLLCIVTGRYSSRLYIAYAPLVVLGTLLASLVPVVGFNAVMTSEHFASFLVFIIIHVVALVYYIKGSLSPKMFKVAVALVVSVGVAVCFAMVAVL
  IALVASSPTKGWSGRSLSLLDPTYASKYIPIIASVSEHQPPTWPSYFMDINVLAFLVPAGIIACFSPLSDASSFVVLYIVTSVYFSGVMVRLMLVLAPAA
  CILSGIALSQAFDVFTRSIKFQLPSLSDNSQAGEGSSENVVPNDSVKADKTEDTSKERTSKKSKKKEKEPVEKPLSKSQIKKRLLVLPLETSVIAIILLV
  LLGAFYVVHSVWAAAEAYSAPSIVLTSHSHDGLHVFDDFREAYAWLSHNTEVDDKVASWWDYGYQTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAA
  WEIFQSLDVKYVLVVFGGLVGYPSDDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSMATPTMLNCLMYKLSYYRFVETDGKAFDRVRRTEIGKKHFK
  LTHFEE
Full Sequence
Protein Sequence     Length: 775     Download
MAASDAQNGV FSVRHAFGNV LAFFILLLIG VLAFSIRLFS VIKYESVIHE FDPYFNYRVT    60
QFLTKNGIYD FWNWFDDRTW YPLGRVIGGT VYPGLTLTAG TLWWILNSLN IPLSVETVCV    120
FTAPIFSAFA SWATYLLTKE VKGAGAGLTA AILLAMVPSY ISRSVAGSYD NEAVAIFALI    180
FTFYLYIKTL NTGSLFYATL NSIAYFYMVC SWGGYTFIIN LIPMHVLLCI VTGRYSSRLY    240
IAYAPLVVLG TLLASLVPVV GFNAVMTSEH FASFLVFIII HVVALVYYIK GSLSPKMFKV    300
AVALVVSVGV AVCFAMVAVL IALVASSPTK GWSGRSLSLL DPTYASKYIP IIASVSEHQP    360
PTWPSYFMDI NVLAFLVPAG IIACFSPLSD ASSFVVLYIV TSVYFSGVMV RLMLVLAPAA    420
CILSGIALSQ AFDVFTRSIK FQLPSLSDNS QAGEGSSENV VPNDSVKADK TEDTSKERTS    480
KKSKKKEKEP VEKPLSKSQI KKRLLVLPLE TSVIAIILLV LLGAFYVVHS VWAAAEAYSA    540
PSIVLTSHSH DGLHVFDDFR EAYAWLSHNT EVDDKVASWW DYGYQTTAMA NRTVIVDNNT    600
WNNTHIATVG TAMSSPEKAA WEIFQSLDVK YVLVVFGGLV GYPSDDINKF LWMVRIGGGV    660
FPHIKEPDYL RDGQYRIDSM ATPTMLNCLM YKLSYYRFVE TDGKAFDRVR RTEIGKKHFK    720
LTHFEEVFTT HHWMVRIYKL KSPKNRIRGK TKKSKSKTSS KTASKRNELK RNPF*         780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1287COG12879.0e-11526748249+
TIGR04154archaeo_STT34.0e-1223284289+
pfam02516STT31.0e-27524700186+
COG1287COG12874.0e-4523434429+
pfam02516STT32.0e-7720434423+
Gene Ontology
GO TermDescription
GO:0004576oligosaccharyl transferase activity
GO:0006486protein glycosylation
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC79544.10167743511118hypothetical protein OsI_20658 [Oryza sativa Indica Group]
RefSeqNP_001056068.1037746786Os05g0519900 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002280521.104377442777PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002325019.104375545759predicted protein [Populus trichocarpa]
RefSeqXP_002514244.104377443778oligosaccharyl transferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2lgz_A052976920269A Chain A, Solution Structure Of Stt3p
PDB3vu0_C0.0000095587036154A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_B0.0000095587036154A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_A0.0000095587036154A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
Transmembrane Domains
StartEnd
2042
84106
113135
145167
174196
211233
240262
272289
302324
366388
393415
506528
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7788675292217490
HO4763975512117460
HO7969143823947750
HO7788671161082235e-32
HO796914213864061.3
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01458.1Aquca_001_00320.1
Arabidopsis lyrata891007488863
Arabidopsis thalianaAT1G34130.1AT5G19690.1
Brachypodium distachyonBradi5g26030.1Bradi2g49640.1Bradi2g19510.1
Brassica rapaBra028034Bra006514Bra002255Bra034441
Carica papayaevm.model.supercontig_467.1.248.439evm.model.supercontig_467.1.248.439evm.model.supercontig_40.47
Capsella rubellaCarubv10008402mCarubv10000271m
Chlamydomonas reinhardtiiCre07.g330100.t1.2g9581.t1
Citrus clementinaCiclev10019005mCiclev10019106mCiclev10007574mCiclev10007513mCiclev10007684m
Citrus sinensisorange1.1g004635morange1.1g005395morange1.1g004678morange1.1g003973m
Cucumis sativusCucsa.122250.1Cucsa.122250.2Cucsa.329260.1Cucsa.329260.2
Eucalyptus grandisEucgr.K02314.1Eucgr.C01008.1
Fragaria vescamrna09173.1-v1.0-hybridmrna11885.1-v1.0-hybrid
Glycine maxGlyma16g33881.1Glyma09g29470.1Glyma01g01270.1Glyma16g08410.1
Gossypium raimondiiGorai.013G004300.1Gorai.013G004300.2Gorai.011G219600.1Gorai.011G219600.4Gorai.011G219600.3
Gorai.011G219600.2Gorai.011G219600.5Gorai.013G229700.1Gorai.010G075800.1Gorai.010G075800.2
Gorai.010G075800.3
Linum usitatissimumLus10041985Lus10017990Lus10043241Lus10011124
Malus domesticaMDP0000299027MDP0000589608MDP0000158858MDP0000201702MDP0000300736
Manihot esculentacassava4.1_002347mcassava4.1_021540m
Medicago truncatulaMedtr6g077750.1Medtr6g077750.2Medtr1g114250.1
Mimulus guttatusmgv1a001976mmgv1a001650m
Oryza sativaLOC_Os04g57890.1LOC_Os05g44360.1LOC_Os05g44360.2
Panicum virgatumPavirv00017930mPavirv00007453mPavirv00022940mPavirv00024588mPavirv00056880m
Pavirv00065583m
Physcomitrella patensPp1s98_21V6.1Pp1s404_37V6.1Pp1s404_38V6.1
Phaseolus vulgarisPhvul.004G139400.1
Picea abiesMA_174842g0010MA_10216317g0010MA_5501292g0010MA_10436134g0010
Populus trichocarpaPotri.012G036300.1Potri.015G028300.1Potri.015G028300.2Potri.018G086000.2Potri.018G086000.1
Potri.006G163600.1
Prunus persicappa001886mppa001464m
Ricinus communis30189.m00167429912.m005461
Setaria italicaSi021341mSi000402mSi021271mSi021321m
Selaginella moellendorffii110405118919
Sorghum bicolorSb06g032800.1Sb09g025920.1Sb03g034385.1
Thellungiella halophilaThhalv10006908mThhalv10012742m
Vitis viniferaGSVIVT01015322001GSVIVT01029339001
Volvox carteriVocar20013212mVocar20003562m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)