y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.005G023300.2
FamilyGH89
Protein PropertiesLength: 797 Molecular Weight: 90951.1 Isoelectric Point: 7.1962
ChromosomeChromosome/Scaffold: 05 Start: 2064442 End: 2084079
Descriptionalpha-N-acetylglucosaminidase family / NAGLU family
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH89927920
  PEIVIRGTTAVEIASGLHWYLKYWCGAHVSWDKTGGIQTTSVPEPGSLPRLKDEGVKIKRPVPWNYYQNVVTSSYSYVWWDWERWEKEVDWMALQGVNLP
  LAFTGQETIWQKVFKDFNITSVDLNNFFGGPAFLAWARMGNLHGWGGPLSQNWLDQQLVLQKQIISRMLELGMTPVLPSFSGNVPAALKRIFPSAKITRL
  GDWNTVDSDPRWCCTYLLDASDPLFVEIGEAFIRKQIKEYGDVTDIYNCDTFNENTPPTNDPEYISTLGAAVYKGISKGDKDAVWLMQGWLFYSDSSFWK
  PPQIKALLHSVPLGKMVVLDLFADVKPIWKSSSQFYGTPYIWCMLHNFGGNIEMYGTLDAISSGPVDARFSANSTMVGVGMCMEGIEHNPIVYELMSEMA
  FRDKKVEVPEWIKSYCNRRYGKVVHEVEAAWEILYHTIYNCTDGIADHNHDFIVMFPDWDPSNSETGVSNNQKKINLLRPVNTRYLLQETPSDKPRAHLW
  YPSDDVIKALQLFLAGGKNLSTSLTYRYDLVDLTRQVLSKFANQLYYKAVSSFQKKNIEALQFHSNKFLQLIKDIDVLLASDDNFLLGTWLESAKKLAVN
  PSEIKQYEWNARTQVTMWFDTNATTQTNKFWSGLVESYYLPRASTYFSHLLESLRQNEKFKLIEWRKQWISQSNKWQEGNELYPVKAKGDALAISQALYE
  K
Full Sequence
Protein Sequence     Length: 797     Download
MLKLGFVFLI LILIPSLPVA LSKYGVMEPL LQRLDSKRAA SSVQEAAAVG LLKRLLPTHL    60
SSFEFKIVSK DVCGGDSCFL INNHKKSSQN EPEIVIRGTT AVEIASGLHW YLKYWCGAHV    120
SWDKTGGIQT TSVPEPGSLP RLKDEGVKIK RPVPWNYYQN VVTSSYSYVW WDWERWEKEV    180
DWMALQGVNL PLAFTGQETI WQKVFKDFNI TSVDLNNFFG GPAFLAWARM GNLHGWGGPL    240
SQNWLDQQLV LQKQIISRML ELGMTPVLPS FSGNVPAALK RIFPSAKITR LGDWNTVDSD    300
PRWCCTYLLD ASDPLFVEIG EAFIRKQIKE YGDVTDIYNC DTFNENTPPT NDPEYISTLG    360
AAVYKGISKG DKDAVWLMQG WLFYSDSSFW KPPQIKALLH SVPLGKMVVL DLFADVKPIW    420
KSSSQFYGTP YIWCMLHNFG GNIEMYGTLD AISSGPVDAR FSANSTMVGV GMCMEGIEHN    480
PIVYELMSEM AFRDKKVEVP EWIKSYCNRR YGKVVHEVEA AWEILYHTIY NCTDGIADHN    540
HDFIVMFPDW DPSNSETGVS NNQKKINLLR PVNTRYLLQE TPSDKPRAHL WYPSDDVIKA    600
LQLFLAGGKN LSTSLTYRYD LVDLTRQVLS KFANQLYYKA VSSFQKKNIE ALQFHSNKFL    660
QLIKDIDVLL ASDDNFLLGT WLESAKKLAV NPSEIKQYEW NARTQVTMWF DTNATTQTNK    720
FWSGLVESYY LPRASTYFSH LLESLRQNEK FKLIEWRKQW ISQSNKWQEG NELYPVKAKG    780
DALAISQALY EKYFAK*                                                   840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam12971NAGLU_N8.0e-234414299+
pfam12972NAGLU_C9.0e-101501793296+
pfam05089NAGLU0157493337+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI24942.10679469867unnamed protein product [Vitis vinifera]
GenBankEEE59081.103979551812hypothetical protein OsJ_10898 [Oryza sativa Japonica Group]
RefSeqNP_196873.102679427805alpha-N-acetylglucosaminidase family / NAGLU family [Arabidopsis thaliana]
RefSeqXP_002273084.1067944802PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002314048.101979521806predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vcc_A051784177867A Chain A, Cpgh89 (E483q, E601q), From Clostridium Perfringens, In Complex With Its Substrate Glcnac-Alpha-1,4-Galactose
PDB2vcb_A051784177867A Chain A, Cpgh89 (E483q, E601q), From Clostridium Perfringens, In Complex With Its Substrate Glcnac-Alpha-1,4-Galactose
PDB2vca_A051784177867A Chain A, Cpgh89 (E483q, E601q), From Clostridium Perfringens, In Complex With Its Substrate Glcnac-Alpha-1,4-Galactose
PDB2vc9_A051784177867A Chain A, Family 89 Glycoside Hydrolase From Clostridium Perfringens In Complex With 2-Acetamido-1,2-Dideoxynojirmycin
PDB4a4a_A051784200890A Chain A, Cpgh89 (E483q, E601q), From Clostridium Perfringens, In Complex With Its Substrate Glcnac-Alpha-1,4-Galactose
Transmembrane Domains
StartEnd
527
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7834553213026220
HO7834551366437720
GT6276572712044740
GT6223562732775490
HO783455336226540.0004
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_057_00157.1Aquca_039_00072.1Aquca_057_00157.2Aquca_057_00157.3Aquca_057_00157.4
Aquca_002_00330.4.155.497Aquca_002_00330.4.155.497Aquca_002_00330.2.100.442Aquca_002_00330.2.100.442Aquca_002_00330.1.155.497
Aquca_002_00330.1.155.497Aquca_002_00330.3.100.434Aquca_002_00330.3.100.434Aquca_002_00330.1.514.887Aquca_002_00330.1.514.887
Aquca_002_00330.3.451.826Aquca_002_00330.3.451.826Aquca_002_00330.2.459.834Aquca_002_00330.2.459.834Aquca_002_00330.4.514.785
Aquca_002_00330.4.514.785
Arabidopsis lyrata488189
Arabidopsis thalianaAT5G13690.1
Brachypodium distachyonBradi1g62007.1Bradi5g24207.1
Brassica rapaBra023429
Carica papayaevm.model.supercontig_125.32evm.model.supercontig_35.39evm.model.supercontig_35.44
Capsella rubellaCarubv10000251m
Citrus clementinaCiclev10030724mCiclev10018883mCiclev10019020mCiclev10019066mCiclev10019065m
Citrus sinensisorange1.1g003545morange1.1g006843morange1.1g006829morange1.1g008173morange1.1g009062m
orange1.1g009057morange1.1g009049morange1.1g012032morange1.1g012026morange1.1g009153m.237.531
orange1.1g009153m.237.531
Cucumis sativusCucsa.128090.1Cucsa.197210.1
Eucalyptus grandisEucgr.B00338.1Eucgr.G03358.1Eucgr.G03358.2Eucgr.B00338.2
Fragaria vescamrna09491.1-v1.0-hybrid.106.845mrna29475.1-v1.0-hybrid
Glycine maxGlyma10g11720.3Glyma06g19791.1.94.437Glyma06g19791.1.94.437Glyma06g19791.1.438.763Glyma06g19791.1.438.763
Gossypium raimondiiGorai.004G170700.1Gorai.004G170700.3Gorai.004G170700.4Gorai.004G170700.2.346.780Gorai.004G170700.2.346.780
Gorai.001G078400.1.96.430Gorai.001G078400.1.96.430Gorai.004G170700.2.108.346Gorai.004G170700.2.108.346Gorai.001G078400.1.466.832
Gorai.001G078400.1.466.832
Linum usitatissimumLus10039598Lus10029494Lus10043468Lus10034116.106.408Lus10034116.106.408
Lus10034116.462.875Lus10034116.462.875
Malus domesticaMDP0000220242MDP0000138607MDP0000208532MDP0000203950MDP0000134637
Manihot esculentacassava4.1_001859mcassava4.1_003710mcassava4.1_022588mcassava4.1_012214m
Medicago truncatulaMedtr3g032980.2.357.804Medtr3g032980.2.357.804Medtr3g032980.1.357.829Medtr3g032980.1.357.829Medtr3g032980.3.95.333
Medtr3g032980.3.95.333Medtr3g032980.2.95.333Medtr3g032980.2.95.333Medtr3g032980.1.95.333Medtr3g032980.1.95.333
Medtr3g032980.3.357.529Medtr3g032980.3.357.529
Mimulus guttatusmgv1a001508mmgv1a018437m
Oryza sativaLOC_Os04g55730.1.99.440LOC_Os04g55730.1.99.440LOC_Os04g55730.1.441.772LOC_Os04g55730.1.441.772
Panicum virgatumPavirv00063217mPavirv00008468mPavirv00041670mPavirv00026596m.238.567Pavirv00026596m.238.567
Physcomitrella patensPp1s329_23V6.1
Phaseolus vulgarisPhvul.005G023300.1Phvul.009G182100.1.92.435Phvul.009G182100.1.92.435Phvul.009G182100.2.253.577Phvul.009G182100.2.253.577
Phvul.009G182100.1.436.760Phvul.009G182100.1.436.760
Picea abiesMA_10437144g0010
Populus trichocarpaPotri.009G058100.1Potri.012G075900.1.100.435Potri.012G075900.1.100.435Potri.012G075900.1.436.751Potri.012G075900.1.436.751
Prunus persicappa001555mppa001642m
Ricinus communis30147.m01401129864.m001461
Setaria italicaSi034295mSi009392m.103.444Si009392m.103.444Si009392m.445.774Si009392m.445.774
Selaginella moellendorffii102402
Sorghum bicolorSb01g034960.1Sb06g030930.1
Thellungiella halophilaThhalv10012727m
Vitis viniferaGSVIVT01032165001GSVIVT01007826001.97.439GSVIVT01007826001.97.439GSVIVT01007826001.468.836GSVIVT01007826001.468.836
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)