| Basic Information | |
|---|---|
| Species | Phaseolus vulgaris |
| Cazyme ID | Phvul.005G023900.1 |
| Family | GH1 |
| Protein Properties | Length: 129 Molecular Weight: 14215.5 Isoelectric Point: 9.4011 |
| Chromosome | Chromosome/Scaffold: 05 Start: 2161751 End: 2166089 |
| Description | beta glucosidase 10 |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 3 | 114 | 5.3e-27 |
| NAYALFGYGVGMSPPHRCSPSLFNCSKGNSSTEPYLAAHHILLAHASAARLYRKKYQAMQLGIIGLNIFSFGYLPKTNSTDDVRAAQRARDFNIGWFMDP ITFGDYPDTMRV | |||
| Full Sequence |
|---|
| Protein Sequence Length: 129 Download |
| MANAYALFGY GVGMSPPHRC SPSLFNCSKG NSSTEPYLAA HHILLAHASA ARLYRKKYQA 60 MQLGIIGLNI FSFGYLPKTN STDDVRAAQR ARDFNIGWFM DPITFGDYPD TMRVGLNLML 120 MKSLLMEG* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| COG2723 | BglB | 7.0e-8 | 3 | 109 | 107 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
| pfam00232 | Glyco_hydro_1 | 3.0e-14 | 6 | 113 | 109 | + Glycosyl hydrolase family 1. | ||
| PLN02998 | PLN02998 | 1.0e-25 | 3 | 116 | 115 | + beta-glucosidase | ||
| PLN02814 | PLN02814 | 1.0e-28 | 2 | 113 | 113 | + beta-glucosidase | ||
| PLN02849 | PLN02849 | 5.0e-35 | 2 | 113 | 112 | + beta-glucosidase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI36853.1 | 1.99965e-42 | 14 | 113 | 1 | 100 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI36856.1 | 6.00036e-42 | 2 | 113 | 662 | 775 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002268147.1 | 5.00264e-43 | 2 | 113 | 205 | 318 | PREDICTED: hypothetical protein isoform 1 [Vitis vinifera] |
| RefSeq | XP_002268189.1 | 8.40779e-45 | 2 | 113 | 101 | 214 | PREDICTED: hypothetical protein isoform 2 [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3gnr_A | 9e-32 | 6 | 113 | 183 | 291 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
| PDB | 3gnp_A | 9e-32 | 6 | 113 | 183 | 291 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
| PDB | 3gno_A | 9e-32 | 6 | 113 | 183 | 291 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| PDB | 3ptq_B | 9e-30 | 9 | 113 | 206 | 311 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| PDB | 3ptq_A | 9e-30 | 9 | 113 | 206 | 311 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| FG228983 | 113 | 2 | 113 | 0 |
| HO789423 | 112 | 2 | 113 | 6e-39 |
| HO785565 | 113 | 2 | 113 | 2e-35 |
| FR609462 | 113 | 2 | 113 | 5e-35 |
| DT008759 | 113 | 3 | 113 | 1e-34 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Vitis vinifera | GSVIVT01028003001 | ||||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |