Basic Information | |
---|---|
Species | Phaseolus vulgaris |
Cazyme ID | Phvul.005G023900.1 |
Family | GH1 |
Protein Properties | Length: 129 Molecular Weight: 14215.5 Isoelectric Point: 9.4011 |
Chromosome | Chromosome/Scaffold: 05 Start: 2161751 End: 2166089 |
Description | beta glucosidase 10 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH1 | 3 | 114 | 5.3e-27 |
NAYALFGYGVGMSPPHRCSPSLFNCSKGNSSTEPYLAAHHILLAHASAARLYRKKYQAMQLGIIGLNIFSFGYLPKTNSTDDVRAAQRARDFNIGWFMDP ITFGDYPDTMRV |
Full Sequence |
---|
Protein Sequence Length: 129 Download |
MANAYALFGY GVGMSPPHRC SPSLFNCSKG NSSTEPYLAA HHILLAHASA ARLYRKKYQA 60 MQLGIIGLNI FSFGYLPKTN STDDVRAAQR ARDFNIGWFM DPITFGDYPD TMRVGLNLML 120 MKSLLMEG* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
COG2723 | BglB | 7.0e-8 | 3 | 109 | 107 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
pfam00232 | Glyco_hydro_1 | 3.0e-14 | 6 | 113 | 109 | + Glycosyl hydrolase family 1. | ||
PLN02998 | PLN02998 | 1.0e-25 | 3 | 116 | 115 | + beta-glucosidase | ||
PLN02814 | PLN02814 | 1.0e-28 | 2 | 113 | 113 | + beta-glucosidase | ||
PLN02849 | PLN02849 | 5.0e-35 | 2 | 113 | 112 | + beta-glucosidase |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CBI36853.1 | 1.99965e-42 | 14 | 113 | 1 | 100 | unnamed protein product [Vitis vinifera] |
EMBL | CBI36856.1 | 6.00036e-42 | 2 | 113 | 662 | 775 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002268147.1 | 5.00264e-43 | 2 | 113 | 205 | 318 | PREDICTED: hypothetical protein isoform 1 [Vitis vinifera] |
RefSeq | XP_002268189.1 | 8.40779e-45 | 2 | 113 | 101 | 214 | PREDICTED: hypothetical protein isoform 2 [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3gnr_A | 9e-32 | 6 | 113 | 183 | 291 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
PDB | 3gnp_A | 9e-32 | 6 | 113 | 183 | 291 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
PDB | 3gno_A | 9e-32 | 6 | 113 | 183 | 291 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
PDB | 3ptq_B | 9e-30 | 9 | 113 | 206 | 311 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
PDB | 3ptq_A | 9e-30 | 9 | 113 | 206 | 311 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FG228983 | 113 | 2 | 113 | 0 |
HO789423 | 112 | 2 | 113 | 6e-39 |
HO785565 | 113 | 2 | 113 | 2e-35 |
FR609462 | 113 | 2 | 113 | 5e-35 |
DT008759 | 113 | 3 | 113 | 1e-34 |
Orthologous Group | |||||
---|---|---|---|---|---|
Species | ID | ||||
Vitis vinifera | GSVIVT01028003001 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|