y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.005G043300.1
FamilyGT50
Protein PropertiesLength: 434 Molecular Weight: 50816.3 Isoelectric Point: 9.1413
ChromosomeChromosome/Scaffold: 05 Start: 4391859 End: 4395992
Descriptionmannosyltransferase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT501284090
  IGTRGNCEPIVCALILWIVICLLKGNVLQSAFWYGLVVHFRIYPIIYSIPIILVLDPNFFPSDQKPVLRNWSAVKGERPKARSGWHNLHYLFKSIFTWNR
  LIFGLVSGLVFLFCTGLFYCLYEWEFLHEAMLYHLTRTDPRHNFSIYFYHIYLHYGHDTSVVEKLISFLPQFLVQLVLIFCFAQDLPFCIFVQTVAFVAF
  NKVITAQYFVWFFCLLPLILPWSKMKLRWDGLSCILLWIGAQTHWLMWGYLLEFKGKNVFLQLWAASLLFLAANIYILVMII
Full Sequence
Protein Sequence     Length: 434     Download
MASLDIRSLL VFSAIFRVIL IVYGEWQDAH MEVRYTDVDY LVFSDAAALM AVGDSPYKRT    60
TYRYSPLLAF LLIPNSYIHR SWGKFLFSAS DILVGYFIYY ILKLRKVPEN MCNYSVMAWL    120
FNPFTFTIGT RGNCEPIVCA LILWIVICLL KGNVLQSAFW YGLVVHFRIY PIIYSIPIIL    180
VLDPNFFPSD QKPVLRNWSA VKGERPKARS GWHNLHYLFK SIFTWNRLIF GLVSGLVFLF    240
CTGLFYCLYE WEFLHEAMLY HLTRTDPRHN FSIYFYHIYL HYGHDTSVVE KLISFLPQFL    300
VQLVLIFCFA QDLPFCIFVQ TVAFVAFNKV ITAQYFVWFF CLLPLILPWS KMKLRWDGLS    360
CILLWIGAQT HWLMWGYLLE FKGKNVFLQL WAASLLFLAA NIYILVMIIR NHKYASVFKA    420
LEYANSKKAA KLE*                                                      480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam05007Mannosyl_trans5.0e-66128409284+
PLN02841PLN0284102433436+
Gene Ontology
GO TermDescription
GO:0005789endoplasmic reticulum membrane
GO:0006506GPI anchor biosynthetic process
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAP59446.1044331434PEANUT1 [Arabidopsis thaliana]
EMBLCBI36197.10314311405unnamed protein product [Vitis vinifera]
RefSeqNP_001132411.1024335443hypothetical protein LOC100193858 [Zea mays]
RefSeqNP_680199.10443316449PNT1 (PEANUT 1); alpha-1,4-mannosyltransferase/ mannosyltransferase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002280567.1044311432PREDICTED: hypothetical protein [Vitis vinifera]
Transmembrane Domains
StartEnd
426
85102
128150
157179
227249
303325
330349
356375
390409
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FF5457832252104340
EV28174322412240
HO8004471381913280
HO800447823274080
EV281743342262590.000002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_040_00057.1Aquca_027_00011.1Aquca_035_00139.1Aquca_027_00005.1Aquca_083_00090.1
Aquca_027_00008.1Aquca_083_00081.1Aquca_008_00278.1
Arabidopsis lyrata910198
Arabidopsis thalianaAT5G22130.2AT5G22130.1
Brachypodium distachyonBradi4g38200.1
Brassica rapaBra020174
Carica papayaevm.model.supercontig_9.382.128.333evm.model.supercontig_9.382.128.333evm.model.supercontig_9.382.364.444evm.model.supercontig_9.382.364.444
Capsella rubellaCarubv10000947m
Chlamydomonas reinhardtiiCre14.g616200.t1.2.125.281Cre14.g616200.t1.2.125.281Cre14.g616200.t1.2.354.469Cre14.g616200.t1.2.354.469
Citrus clementinaCiclev10001079m
Citrus sinensisorange1.1g012470morange1.1g020664morange1.1g014361m.155.293orange1.1g014361m.292.401orange1.1g014361m.292.401
orange1.1g014361m.155.293orange1.1g020629m
Cucumis sativusCucsa.099160.1
Eucalyptus grandisEucgr.H00040.1
Fragaria vescamrna23760.1-v1.0-hybrid
Glycine maxGlyma08g16980.1
Gossypium raimondiiGorai.001G088100.1
Linum usitatissimumLus10000321Lus10013349
Malus domesticaMDP0000259191MDP0000246795MDP0000134018
Manihot esculentacassava4.1_033019m
Medicago truncatulaMedtr8g040610.1
Mimulus guttatusmgv1a006636mmgv1a019000mmgv1a018848m
Oryza sativaLOC_Os03g46750.1
Panicum virgatumPavirv00041326mPavirv00060844m
Physcomitrella patensPp1s171_137V6.1
Picea abiesMA_10434160g0010
Populus trichocarpaPotri.001G031500.1Potri.001G031500.2
Prunus persicappa005934m
Ricinus communis30040.m000266
Setaria italicaSi029845m
Selaginella moellendorffii90874
Sorghum bicolorSb02g011300.1
Thellungiella halophilaThhalv10015361mThhalv10013575m
Vitis viniferaGSVIVT01017167001
Volvox carteriVocar20014433m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny