y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.005G057900.1
FamilyGT33
Protein PropertiesLength: 481 Molecular Weight: 53814.3 Isoelectric Point: 7.138
ChromosomeChromosome/Scaffold: 05 Start: 7741219 End: 7750686
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT33154710
  RACVVVLGDIGRSPRMQYHALSLANQASLEVDVVAYGGSEPHTALLANPSIHFHIMKQWFTASQRLPKILQPIMLLLKPLVQFLMLLWFLCVKIPSPGVF
  IVQNPPSVPTLVAVKWASWLRNSYFVIDWHNFGYTLLALSLGRNSHFVSLYKWFEKHYGNMADASLCVTKAMQHELAQNWGINATVLYDQPPDIFHPASL
  EERHKLFCRLNEDLFQPLGVRDCVSNGNSLIASRETLFTTEVGSSIHLKPNRPALVVSSTSWTPDEDFSILLEAAVMYDRRVAAILGEDDSVDEEVMWKE
  ISDGKQYLYPRLLFIITGKGPEKEKYEAKIKRLKLKRVAFRTMWLSADDYPLLLGSADLGVCLHTSSSGLDLPMKVVDMFGCGLPVCAVSYSCIKELVRV
  DNNGLLFSSSSELADELLLLFKGFPDDCDALKVLKYGALETGSSARWATEWEEHAKP
Full Sequence
Protein Sequence     Length: 481     Download
MAGKSNEKKG GRRGRACVVV LGDIGRSPRM QYHALSLANQ ASLEVDVVAY GGSEPHTALL    60
ANPSIHFHIM KQWFTASQRL PKILQPIMLL LKPLVQFLML LWFLCVKIPS PGVFIVQNPP    120
SVPTLVAVKW ASWLRNSYFV IDWHNFGYTL LALSLGRNSH FVSLYKWFEK HYGNMADASL    180
CVTKAMQHEL AQNWGINATV LYDQPPDIFH PASLEERHKL FCRLNEDLFQ PLGVRDCVSN    240
GNSLIASRET LFTTEVGSSI HLKPNRPALV VSSTSWTPDE DFSILLEAAV MYDRRVAAIL    300
GEDDSVDEEV MWKEISDGKQ YLYPRLLFII TGKGPEKEKY EAKIKRLKLK RVAFRTMWLS    360
ADDYPLLLGS ADLGVCLHTS SSGLDLPMKV VDMFGCGLPV CAVSYSCIKE LVRVDNNGLL    420
FSSSSELADE LLLLFKGFPD DCDALKVLKY GALETGSSAR WATEWEEHAK PLITEVLSRF    480
*                                                                    540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd01635Glycosyltransferase_GTB_type6.0e-832341897+
cd03801GT1_YqgM_like6.0e-830418398+
COG0438RfaG1.0e-886418337+
PLN02275PLN02275011418408+
cd03816GT1_ALG1_like013473463+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI19390.1014781480unnamed protein product [Vitis vinifera]
RefSeqXP_002283369.101478116595PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002330745.10114752467predicted protein [Populus trichocarpa]
RefSeqXP_002465752.10124777470hypothetical protein SORBIDRAFT_01g045200 [Sorghum bicolor]
RefSeqXP_002532170.1084793473beta1,4 mannosyltransferase, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FG90402723312330
DW01729325512510
CB5400432142054180
DV1321852691344020
GO872658334123450
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_718_00001.2Aquca_095_00006.1.267.395Aquca_095_00006.1.10.256Aquca_095_00006.1.10.256Aquca_095_00006.2.10.256
Aquca_095_00006.2.10.256Aquca_095_00006.1.267.395Aquca_718_00001.1Aquca_060_00040.3Aquca_095_00006.2.267.381
Aquca_095_00006.2.267.381Aquca_060_00040.2Aquca_060_00040.1
Arabidopsis lyrata490368879948912013
Arabidopsis thalianaAT1G16570.1AT1G16570.2
Brachypodium distachyonBradi1g72620.1
Brassica rapaBra026714Bra026039
Carica papayaevm.model.supercontig_132.61
Capsella rubellaCarubv10009200mCarubv10008948m
Chlamydomonas reinhardtiiCre12.g516550.t1.2
Citrus clementinaCiclev10001033mCiclev10001025mCiclev10001005m
Citrus sinensisorange1.1g015058morange1.1g014316morange1.1g011690morange1.1g011969morange1.1g011979m
Cucumis sativusCucsa.034380.1
Eucalyptus grandisEucgr.F01412.2Eucgr.F01412.1
Fragaria vescamrna02356.1-v1.0-hybrid
Glycine maxGlyma15g40830.1Glyma15g40830.2Glyma08g18130.2
Gossypium raimondiiGorai.007G217600.1Gorai.007G217900.6Gorai.007G217900.3.324.433Gorai.007G217900.3.13.332Gorai.007G217900.7
Gorai.007G217900.3.13.332Gorai.006G005600.3.168.254Gorai.006G005600.3.168.254Gorai.007G217900.3.324.433Gorai.007G217900.5.326.428
Gorai.007G217900.5.326.428Gorai.006G005600.2.168.254Gorai.006G005600.2.168.254Gorai.006G005600.1.168.319Gorai.007G217900.4
Gorai.006G005600.1.168.319Gorai.007G217900.1Gorai.007G217900.2
Linum usitatissimumLus10031569.147.292Lus10031569.147.292Lus10026065Lus10014357
Malus domesticaMDP0000161006.80.246MDP0000159170MDP0000159220MDP0000161006.80.246MDP0000161006.247.440
MDP0000161006.247.440
Manihot esculentacassava4.1_013829mcassava4.1_014658mcassava4.1_016683mcassava4.1_016689m
Medicago truncatulaMedtr2g069330.1
Mimulus guttatusmgv1a005765m
Oryza sativaLOC_Os03g08300.2LOC_Os03g08300.1LOC_Os06g36890.1
Panicum virgatumPavirv00056539mPavirv00038448m
Physcomitrella patensPp1s12_194V6.1
Picea abiesMA_179056g0010
Populus trichocarpaPotri.001G394300.4Potri.001G394300.1Potri.001G394300.2Potri.001G394300.3
Prunus persicappa006637mppa005066mppa005033m
Ricinus communis27893.m000222
Setaria italicaSi035510m
Selaginella moellendorffii82712
Sorghum bicolorSb01g045200.1
Thellungiella halophilaThhalv10007520mThhalv10007572m
Vitis viniferaGSVIVT01009332001
Volvox carteriVocar20014254m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)