y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.005G059700.1
FamilyAA2
Protein PropertiesLength: 385 Molecular Weight: 42952.7 Isoelectric Point: 8.1571
ChromosomeChromosome/Scaffold: 05 Start: 8163314 End: 8166038
DescriptionPeroxidase superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2843650
  HRDVAPALLRLFFHDCFIQGCDASLLLDENDGNNNRSVEKQAVPNQTLRGFDKIDLIKEEVEQACPGVVSCADIVSLAARDSVLLAGGPFYPVLTGRRDN
  HQSFFKEATDQIPRPDDNVTRTLHLFNLRGFNARETVSLLGGHNIGKIGCDFIQQRLYNFHNTRQPDPTIPLDFLRQMRLNCPNNSNTNIDEFVTSKPTS
  SDVHSKPGMSYMQALSSSVSSGSTFDTHYFQSLLRGRGLLFADQQLMAEDRTAKLVSAYASDDGSTFRMDFARVMLKMSNLD
Full Sequence
Protein Sequence     Length: 385     Download
MRSCINLWIV VALVVPVLLS LRRPRGETKT QTASSSFSVK LANSLHFNKR IRDGSNLEYD    60
FYRNTCPQAE GIVRSALTRI YFDHRDVAPA LLRLFFHDCF IQGCDASLLL DENDGNNNRS    120
VEKQAVPNQT LRGFDKIDLI KEEVEQACPG VVSCADIVSL AARDSVLLAG GPFYPVLTGR    180
RDNHQSFFKE ATDQIPRPDD NVTRTLHLFN LRGFNARETV SLLGGHNIGK IGCDFIQQRL    240
YNFHNTRQPD PTIPLDFLRQ MRLNCPNNSN TNIDEFVTSK PTSSDVHSKP GMSYMQALSS    300
SVSSGSTFDT HYFQSLLRGR GLLFADQQLM AEDRTAKLVS AYASDDGSTF RMDFARVMLK    360
MSNLDVLTGP QGQVRLNCSK PVTS*                                          420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00141peroxidase0.00531634530+
cd00314plant_peroxidase_like3.0e-1773363298+
pfam00141peroxidase2.0e-5773226155+
PLN03030PLN030305.0e-7761379323+
cd00693secretory_peroxidase1.0e-13756380327+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI36139.101138020402unnamed protein product [Vitis vinifera]
RefSeqXP_002269658.1013841375PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002279534.101138020367PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002310681.10573795310predicted protein [Populus trichocarpa]
RefSeqXP_002513376.10838411385Peroxidase 57 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1sch_B0573802292A Chain A, Peanut Peroxidase
PDB1sch_A0573802292A Chain A, Peanut Peroxidase
PDB1qo4_A0573803302A Chain A, Peanut Peroxidase
PDB1pa2_A0573803302A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB3hdl_A0563791300A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
Signal Peptide
Cleavage Site
20
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EV265428288222960
DT747438294873800
EX669402177562320
DT762021286483310
CV005782199552530
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_024_00148.1Aquca_020_00226.1Aquca_020_00219.1Aquca_020_00225.1
Arabidopsis lyrata857184
Arabidopsis thalianaAT4G33870.1
Brachypodium distachyonBradi2g48050.1
Brassica rapaBra011475Bra024033
Carica papayaevm.model.supercontig_34.24evm.model.supercontig_98.23
Capsella rubellaCarubv10004951mCarubv10006531m
Citrus clementinaCiclev10025449mCiclev10017909mCiclev10026177m
Citrus sinensisorange1.1g035578morange1.1g043399morange1.1g016209m
Cucumis sativusCucsa.239780.1
Eucalyptus grandisEucgr.F01472.1Eucgr.F03025.1
Fragaria vescamrna29953.1-v1.0-hybridmrna29957.1-v1.0-hybridmrna29954.1-v1.0-hybrid
Glycine maxGlyma08g17850.2Glyma15g41280.1
Malus domesticaMDP0000486228MDP0000254277
Manihot esculentacassava4.1_025400m
Medicago truncatulaMedtr4g012870.1
Mimulus guttatusmgv1a019717m
Oryza sativaLOC_Os01g51550.1
Panicum virgatumPavirv00060522m
Phaseolus vulgarisPhvul.005G059500.1
Picea abiesMA_177017g0010
Populus trichocarpaPotri.007G067200.1Potri.007G067200.2Potri.001G182400.1
Prunus persicappa018541mppa007961m
Ricinus communis30146.m00360130169.m006321
Setaria italicaSi003773m
Selaginella moellendorffii115533
Sorghum bicolorSb04g019270.1
Thellungiella halophilaThhalv10025607mThhalv10027558m.213.419Thhalv10027558m.213.419
Vitis viniferaGSVIVT01010156001GSVIVT01017084001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny