y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.005G066500.1
FamilyGT22
Protein PropertiesLength: 536 Molecular Weight: 60778.7 Isoelectric Point: 9.0649
ChromosomeChromosome/Scaffold: 05 Start: 10261446 End: 10266658
DescriptionAlg9-like mannosyltransferase family
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT22474460
  ALGFLRYMSATSNIIHDCDEVFNYWEPLHYLLYKTGFQTWEYSSQYALRSYLYLLFHEVVGRPASWLFSEDKVRVFYAVRFFLGLLSVITDTVLVVALSR
  KYGKRLATYALAMLCLTSGCFFASTSFLPSSFSMYAISLASGLFLLDKPASAISVAVIGVILGWPFSILAFLPVTVYSLSRKFKGAFIAATVTSVILLPL
  SIVTDFYYYGKWTSSVLNLLIYNVAGGGESHLYGIEGPLYYLRNGFNNFNFCFVLALLFLAILPIAKKKYAPDLLIVISPIYIWLGFMSLQPHKEERFLY
  PIYPLICVAASAVIESFPDLFRSKYNPYDRSIIVTVAKVMRPLALSLILYASHARTFSLIHGYSAPLEVYKIFEHHDAEKNSVLCVGSEWHRFPSSFFIP
Full Sequence
Protein Sequence     Length: 536     Download
MALSAVRQRR SEASDPSPSE PYTKLDKPQR SEEKDDKGLG WFFPFVALGF LRYMSATSNI    60
IHDCDEVFNY WEPLHYLLYK TGFQTWEYSS QYALRSYLYL LFHEVVGRPA SWLFSEDKVR    120
VFYAVRFFLG LLSVITDTVL VVALSRKYGK RLATYALAML CLTSGCFFAS TSFLPSSFSM    180
YAISLASGLF LLDKPASAIS VAVIGVILGW PFSILAFLPV TVYSLSRKFK GAFIAATVTS    240
VILLPLSIVT DFYYYGKWTS SVLNLLIYNV AGGGESHLYG IEGPLYYLRN GFNNFNFCFV    300
LALLFLAILP IAKKKYAPDL LIVISPIYIW LGFMSLQPHK EERFLYPIYP LICVAASAVI    360
ESFPDLFRSK YNPYDRSIIV TVAKVMRPLA LSLILYASHA RTFSLIHGYS APLEVYKIFE    420
HHDAEKNSVL CVGSEWHRFP SSFFIPDYVG QVRWIDEGFR GLLPFPFNST LGGTAAAPPY    480
FNNKNMASGE QYPIAALPYL DRELSPALYR SFFIPYLWQE KNIFGTYKLF KRVTT*        540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03901Glyco_transf_225.0e-9541446434+
Gene Ontology
GO TermDescription
GO:0006506GPI anchor biosynthetic process
GO:0016757transferase activity, transferring glycosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN72375.1045333568hypothetical protein [Vitis vinifera]
RefSeqNP_173134.2015331568sugar binding / transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002285438.1045333568PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002316862.1065341565predicted protein [Populus trichocarpa]
RefSeqXP_002523375.1015331567glycosyltransferase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
3961
122144
156178
198220
233255
287309
316334
344363
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FE710667286283130
FG88492723012300
EL453002307513530
ES91045329512910
GO32331325862600
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_021_00239.3Aquca_021_00239.2Aquca_021_00239.1
Arabidopsis lyrata471892
Arabidopsis thalianaAT1G16900.1
Brachypodium distachyonBradi2g06627.1Bradi2g06627.2
Brassica rapaBra016625Bra026017
Carica papayaevm.model.supercontig_97.103
Capsella rubellaCarubv10008988mCarubv10008626m
Citrus clementinaCiclev10019496m
Citrus sinensisorange1.1g009200morange1.1g008307m
Cucumis sativusCucsa.057600.1
Eucalyptus grandisEucgr.F01228.1
Fragaria vescamrna27242.1-v1.0-hybrid
Glycine maxGlyma13g34570.2Glyma12g35831.2Glyma12g35831.1Glyma13g34570.1
Gossypium raimondiiGorai.013G173400.1
Linum usitatissimumLus10028153Lus10042853
Malus domesticaMDP0000250399MDP0000193605
Manihot esculentacassava4.1_004544m
Medicago truncatulaMedtr2g076680.1
Mimulus guttatusmgv1a003735m
Oryza sativaLOC_Os01g11070.1
Panicum virgatumPavirv00044939m
Physcomitrella patensPp1s478_15V6.1
Picea abiesMA_10429532g0010
Populus trichocarpaPotri.011G110800.1Potri.011G110800.2Potri.011G110800.3
Prunus persicappa003475m
Ricinus communis28842.m000906
Setaria italicaSi000820m
Selaginella moellendorffii442454
Sorghum bicolorSb03g002210.1
Thellungiella halophilaThhalv10007218m
Vitis viniferaGSVIVT01014208001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny