y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.005G081600.1
FamilyGT4
Protein PropertiesLength: 408 Molecular Weight: 45581.7 Isoelectric Point: 8.2652
ChromosomeChromosome/Scaffold: 05 Start: 19333069 End: 19341619
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT42123741.50001e-40
  FLSINRFEKKKNIQLAISAFALLHSPEGIFKHKDITNATLTIAGGFDKRLKENVEYIEELKDLAEKKGVSSKIRFITSCPTDERNALLSECLCVLYTPKD
  EHFGIVPLEAMAAYKPVIACNSGGPVESIKNGVTGFLCDPTPQEFSSAMAKLLNDPQGAEKMG
Full Sequence
Protein Sequence     Length: 408     Download
MGKGTSSKLN IAIIHPDLGI GGAERLIVDA AVELASQGHK VHVFTAHHDK NRCFEETVAG    60
TFPVTVYGSF LPRHVFYRLH ALCAYLRCLF VAFCVLFMWH SFDVVLADQV SVVIPIFKLK    120
RSIKVVFYCH FPDLLLAQHS TFIRRMYRKP IDYVEEITTG MADLILVNSN FTASTFANTF    180
KSLDAKGIRP AVLYPAVNVD QFNEPSSFKL NFLSINRFEK KKNIQLAISA FALLHSPEGI    240
FKHKDITNAT LTIAGGFDKR LKENVEYIEE LKDLAEKKGV SSKIRFITSC PTDERNALLS    300
ECLCVLYTPK DEHFGIVPLE AMAAYKPVIA CNSGGPVESI KNGVTGFLCD PTPQEFSSAM    360
AKLLNDPQGA EKMGREARRH VDESFSTKSF GQYLNRYLVD IHRGKED*                 420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0438RfaG1.0e-398405403+
cd03811GT1_WabH_like1.0e-4210386389+
cd03798GT1_wlbH_like1.0e-439397413+
cd03801GT1_YqgM_like3.0e-5310386390+
cd03805GT1_ALG2_like09394399+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM26674.1014071403At1g78800/F9K20_16 [Arabidopsis thaliana]
GenBankACU21459.1014071407unknown [Glycine max]
RefSeqNP_178001.2014071403glycosyl transferase family 1 protein [Arabidopsis thaliana]
RefSeqXP_002317454.1084074413predicted protein [Populus trichocarpa]
RefSeqXP_002525620.1014071408alpha-1,3-mannosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2f9f_A5e-1620437213168A Chain A, Crystal Structure Of The Putative Mannosyl Transferase (Wbaz-1)from Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr29a
PDB3c48_B0.000000000002162395185419A Chain A, Structure Of The Retaining Glycosyltransferase Msha: The First Step In Mycothiol Biosynthesis. Organism: Corynebacterium Glutamicum- Apo (Open) Structure.
PDB3c48_A0.000000000002162395185419A Chain A, Structure Of The Retaining Glycosyltransferase Msha: The First Step In Mycothiol Biosynthesis. Organism: Corynebacterium Glutamicum- Apo (Open) Structure.
PDB3c4v_B0.000000000002162395165399A Chain A, Structure Of The Retaining Glycosyltransferase Msha: The First Step In Mycothiol Biosynthesis. Organism: Corynebacterium Glutamicum- Apo (Open) Structure.
PDB3c4v_A0.000000000002162395165399A Chain A, Structure Of The Retaining Glycosyltransferase Msha: The First Step In Mycothiol Biosynthesis. Organism: Corynebacterium Glutamicum- Apo (Open) Structure.
Transmembrane Domains
StartEnd
83102
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CK27432531363160
EL44718731513150
EL45605231563200
EV263639249623100
EV263639393033410.0000000003
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_021_00182.1Aquca_021_00182.2Aquca_021_00182.3
Arabidopsis lyrata477043
Arabidopsis thalianaAT1G78800.1
Brachypodium distachyonBradi5g19840.1
Brassica rapaBra035064
Carica papayaevm.model.supercontig_77.17
Capsella rubellaCarubv10022022m
Chlamydomonas reinhardtiig1920.t1
Citrus clementinaCiclev10022599mCiclev10020399m
Citrus sinensisorange1.1g036860m
Cucumis sativusCucsa.220170.2Cucsa.273740.2Cucsa.273740.1Cucsa.220170.1
Eucalyptus grandisEucgr.F01245.1
Fragaria vescamrna27271.1-v1.0-hybrid
Glycine maxGlyma12g35950.2Glyma12g35950.1Glyma13g34430.1Glyma13g34430.2
Gossypium raimondiiGorai.002G054000.2Gorai.002G054000.1
Linum usitatissimumLus10037008Lus10015797
Malus domesticaMDP0000319369MDP0000185482
Manihot esculentacassava4.1_008785m
Medicago truncatulaMedtr1g104880.1
Mimulus guttatusmgv1a007424m
Oryza sativaLOC_Os04g49960.1
Panicum virgatumPavirv00018845mPavirv00056995mPavirv00050038mPavirv00004378m
Physcomitrella patensPp1s246_77V6.1
Picea abiesMA_499839g0010
Populus trichocarpaPotri.011G109000.1
Prunus persicappa006490mppa006502m
Ricinus communis29681.m001322
Setaria italicaSi017356mSi013830mSi010219m
Selaginella moellendorffii419620
Sorghum bicolorSb06g026860.1
Thellungiella halophilaThhalv10019736mThhalv10007837m
Vitis viniferaGSVIVT01014186001
Volvox carteriVocar20014584m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny