y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.005G093500.1
FamilyGT1
Protein PropertiesLength: 440 Molecular Weight: 49377.9 Isoelectric Point: 6.4591
ChromosomeChromosome/Scaffold: 05 Start: 27913402 End: 27921400
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT1574036.8e-23
  LITFFPINVPHVEGLPHGAETTSDVSFSLGPLIMTAMDRTERDIELLLLDLKPQIVFFNFTYWLPNITSRLGIKSFQYFILSPATVSYTTAPPRMNHKGS
  LTELDLMQPPLGYPVSSIKLHAHEAKFLASKRNWEFGSGVLFYDRLNNEQFGKSVVLSGPIIPEPPNTVLDEKWSAWLGSFKDGSVVFCALGSEWKLPHG
  QFQELLLGLELTGLPFLAVVKVPIGFETIEAALPEGFKERIEGRGIVHSGWIQQQLILEHSSVGCFITHCGAGSLTEALVNKCQMVLLPQLDGDHIINAR
  MMGSNLKVGVEVEKGEEDGWFTKESVSKAVKIVMDEENEVGREVREN
Full Sequence
Protein Sequence     Length: 440     Download
MDSSSLHIAM FPWFAMGHLT PYLHLSNKLA KRGHKISFFI PRRTQSKLEQ FNLFPDLITF    60
FPINVPHVEG LPHGAETTSD VSFSLGPLIM TAMDRTERDI ELLLLDLKPQ IVFFNFTYWL    120
PNITSRLGIK SFQYFILSPA TVSYTTAPPR MNHKGSLTEL DLMQPPLGYP VSSIKLHAHE    180
AKFLASKRNW EFGSGVLFYD RLNNEQFGKS VVLSGPIIPE PPNTVLDEKW SAWLGSFKDG    240
SVVFCALGSE WKLPHGQFQE LLLGLELTGL PFLAVVKVPI GFETIEAALP EGFKERIEGR    300
GIVHSGWIQQ QLILEHSSVG CFITHCGAGS LTEALVNKCQ MVLLPQLDGD HIINARMMGS    360
NLKVGVEVEK GEEDGWFTKE SVSKAVKIVM DEENEVGREV RENHAKLRNF LERFIPKFGV    420
NFRILGENGD DWAKENIQS*                                                480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02863PLN028633.0e-227362409+
PLN02670PLN026707.0e-522390431+
PLN02764PLN027642.0e-1001411439+
PLN00414PLN004143.0e-1014411431+
PLN02208PLN022082.0e-1045411437+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABL74480.1034115437glucosyltransferase [Ipomoea batatas]
GenBankACU24192.1014111436unknown [Glycine max]
DDBJBAD95881.1034115437glucosyltransferase [Ipomoea nil]
RefSeqXP_002331944.10104111424predicted protein [Populus trichocarpa]
RefSeqXP_002522508.1014111435UDP-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A1e-1824323467A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9
PDB2vch_A1e-1824323467A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9
PDB2vce_A1e-1824323467A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2c9z_A2e-18217415249433A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2c1z_A2e-18217415249433A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778286405324110
FE685127248342560
FE685128266482880
FS33514825522310
HO778286279350.00004
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_055_00117.1Aquca_038_00188.1Aquca_055_00115.1Aquca_023_00112.1Aquca_011_00587.1
Aquca_011_00580.1
Arabidopsis lyrata474186918511492036495482918509
475492
Arabidopsis thalianaAT3G29630.1AT5G53990.1AT5G54010.1AT5G54060.1AT1G64910.1
Brassica rapaBra029046Bra022688Bra029045
Carica papayaevm.model.supercontig_8.121
Capsella rubellaCarubv10027945m
Citrus clementinaCiclev10017784mCiclev10008184mCiclev10015186m
Citrus sinensisorange1.1g039043morange1.1g017557morange1.1g012080m
Cucumis sativusCucsa.032470.1Cucsa.148900.1Cucsa.148870.1Cucsa.148880.1Cucsa.180970.1
Eucalyptus grandisEucgr.F03293.1Eucgr.F03295.1Eucgr.K01076.1Eucgr.K01079.1Eucgr.F03297.1
Fragaria vescamrna16456.1-v1.0-hybridmrna27158.1-v1.0-hybridmrna20937.1-v1.0-hybridmrna29784.1-v1.0-hybridmrna13733.1-v1.0-hybrid
mrna16457.1-v1.0-hybrid
Glycine maxGlyma10g33790.1Glyma20g33810.1Glyma12g34045.1Glyma06g43880.1Glyma12g14050.1
Glyma13g36500.1Glyma13g36490.1Glyma06g35110.1Glyma12g34030.1Glyma08g44550.1
Glyma13g32770.1
Gossypium raimondiiGorai.007G157200.1Gorai.002G066600.1Gorai.002G065400.1Gorai.002G065400.2Gorai.002G065300.1
Gorai.010G242800.1Gorai.002G065500.1Gorai.010G230400.1Gorai.010G230200.1Gorai.009G439200.1
Linum usitatissimumLus10008453Lus10013337Lus10040178
Malus domesticaMDP0000311492MDP0000729320MDP0000319451MDP0000729321
Manihot esculentacassava4.1_028194mcassava4.1_024244mcassava4.1_026854mcassava4.1_021802mcassava4.1_007290m
Medicago truncatulaMedtr4g079270.1Medtr4g079250.1Medtr2g014900.1Medtr2g083390.1Medtr2g083420.1
Mimulus guttatusmgv1a019428mmgv1a006277mmgv1a006102mmgv1a006231mmgv1a021196m
Panicum virgatumPavirv00057507m
Phaseolus vulgarisPhvul.007G135800.1Phvul.011G136400.1Phvul.011G115700.1Phvul.005G093600.1Phvul.011G128700.1
Phvul.011G138500.1Phvul.011G138600.1Phvul.005G093300.1Phvul.005G093500.2
Populus trichocarpaPotri.011G061000.1Potri.011G060300.1Potri.006G179700.1Potri.011G097900.1
Prunus persicappa022356mppa024453m
Ricinus communis29900.m00155029705.m000575
Sorghum bicolorSb08g003060.1
Thellungiella halophilaThhalv10013536mThhalv10013535mThhalv10028656mThhalv10013471m
Vitis viniferaGSVIVT01014265001GSVIVT01014272001GSVIVT01014269001GSVIVT01014271001GSVIVT01014270001
GSVIVT01014267001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)