y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.005G099900.1
FamilyAA4
Protein PropertiesLength: 566 Molecular Weight: 62636.9 Isoelectric Point: 7.5728
ChromosomeChromosome/Scaffold: 05 Start: 30169457 End: 30177519
DescriptionFAD-linked oxidases family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA41073111.3e-21
  RYFEGILGNKNVVQDEDKLVTSNTDWMHKYKGSSKLLLQPRTTDQVAQILKYCNSRCLAVVPQGGNTGLVGGSVPVFDEVIISLSSMNKIISFDKVSGIL
  VCEAGCILENIMSFLDNEGFIMPLDLGAKGSCQIGGNVSTNAGGLRLVRYGSLHGNVLGVEAVLANGTVLDMLKTLRKDNTGYDLKHLFIGSEGSLGIVT
  KVSIL
Full Sequence
Protein Sequence     Length: 566     Download
MARHNSRVTL RFLLSSFPDR SRNPPLLPSA TATFSSCFTT GFDEKRRLLQ CNIVREDQQV    60
FSFFKPLRNF IEIKQWGVGI QRKRYGSLAG LVQRNPRFSK LNDDDVRYFE GILGNKNVVQ    120
DEDKLVTSNT DWMHKYKGSS KLLLQPRTTD QVAQILKYCN SRCLAVVPQG GNTGLVGGSV    180
PVFDEVIISL SSMNKIISFD KVSGILVCEA GCILENIMSF LDNEGFIMPL DLGAKGSCQI    240
GGNVSTNAGG LRLVRYGSLH GNVLGVEAVL ANGTVLDMLK TLRKDNTGYD LKHLFIGSEG    300
SLGIVTKVSI LTPPKLSSVN VAFLACKDYN SCQKLLQEAK RKLGEILSAF EFLDVQSMNL    360
VLNHLEGARN PIPTSLHNFY VLIETTGSDE SSDKQKLEAF LLGSMENELI SDGVLAQDIN    420
QASSFWLLRE GIPEALMKAG AVYKYDLSVP LEHMYNLVEE MRSRLGNTAN VIGYGHLGDG    480
NLHLNVSTPH YDDKILSQIE PFVYEWTSKH RGSISAEHGI GLMKANEIYY SKSLETVQVM    540
ASIKNLMDPN HILNPYKVLP HSLTS*                                         600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01565FAD_binding_46.0e-37141277137+
PLN02805PLN028055.0e-4386560523+
pfam02913FAD-oxidase_C6.0e-57315558252+
TIGR00387glcD3.0e-72146557423+
COG0277GlcD5.0e-108108561467+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0008762UDP-N-acetylmuramate dehydrogenase activity
GO:0016491oxidoreductase activity
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI17437.101335651433unnamed protein product [Vitis vinifera]
RefSeqNP_568003.208156574558FAD linked oxidase family protein [Arabidopsis thaliana]
RefSeqXP_002268002.103656512550PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002310828.108356549528predicted protein [Populus trichocarpa]
RefSeqXP_002521506.107856577564d-lactate dehydrognease 2, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3pm9_F010155913476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_E010155913476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_D010155913476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_C010155913476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_B010155913476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8387753301464750
CO0713632831294110
CO0718242841294120
GO8395253311354650
HO4192754041605620
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00314.2Aquca_007_00314.4Aquca_007_00314.1Aquca_007_00314.5Aquca_007_00314.3
Arabidopsis lyrata490996
Arabidopsis thalianaAT4G36400.1AT4G36400.2AT5G06580.1
Brachypodium distachyonBradi1g56880.1
Brassica rapaBra017758
Carica papayaevm.model.supercontig_6.186
Capsella rubellaCarubv10006814m
Chlamydomonas reinhardtiiCre10.g434900.t1.3
Citrus clementinaCiclev10025317mCiclev10025522mCiclev10025687m
Citrus sinensisorange1.1g009112morange1.1g011827morange1.1g012299morange1.1g014408morange1.1g014546m
Cucumis sativusCucsa.201090.1Cucsa.201090.2
Eucalyptus grandisEucgr.I02388.1Eucgr.I02389.3Eucgr.I02389.1Eucgr.I02389.2
Fragaria vescamrna14901.1-v1.0-hybrid
Glycine maxGlyma01g37490.2Glyma01g37490.3
Gossypium raimondiiGorai.011G100400.1Gorai.011G100400.2
Linum usitatissimumLus10028342Lus10041792
Medicago truncatulaMedtr5g021240.1
Mimulus guttatusmgv1a003621m
Oryza sativaLOC_Os07g06890.1LOC_Os07g08950.1
Panicum virgatumPavirv00006739m
Physcomitrella patensPp1s6_281V6.1Pp1s44_301V6.1
Picea abiesMA_159144g0160MA_159128g0010MA_159099g0380
Populus trichocarpaPotri.007G018600.5Potri.007G018600.3Potri.007G018600.1Potri.007G018600.2Potri.007G018600.4
Prunus persicappa003765mppa003656m
Ricinus communis29634.m002061
Setaria italicaSi029317m
Sorghum bicolorSb02g003640.1
Thellungiella halophilaThhalv10024815m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny