y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.005G103600.1
FamilyGT48
Protein PropertiesLength: 1753 Molecular Weight: 204939 Isoelectric Point: 9.0939
ChromosomeChromosome/Scaffold: 05 Start: 30942326 End: 30947688
Descriptionglucan synthase-like 5
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT4885516050
  VPVNLEARRRITFFTNSLFMKMPHAPQVEKMMAFSVLTPYYSEEVVYSKEQLRVGNEDGISTLYYLQTIYDDEWKNFMERMRREGMKNESDIWTHKLGDL
  RSWASYRGQTLSRTVRGMMYYYKSLKLLAFLDSASEVEIREGTRELVSLNQDNSDGFSSNKSPPSPMSLSTENSSARLLFKGHDYGTASMKFTYVISCQI
  YGAQKERKDPRAEEILYLMKNNEALRVAYVDEVPFGSGEKEYYSVLAKYDQQLEREVEIYRVKLPGPIKLGEGKPENQNHAIIFTRGDAVQTIDMNQDNY
  FEEALKMRNLLEEYRYYYGIRKPTILGMREHIFTAFVSSLAWFMSAQEMSFVTLGQRVLANPLKVRMHYGHPDVFDRFWFITRGGISKASRVINISEDIF
  AGFNCTLRGGNVTHHEYIQVGKGRDVGLNQVSMFEAKVASGNGEQVLSRDVYRLGHKLDFFRMLSFFYTTVGFFFNTMMVVLTVYAFLWGRLMLALSGIE
  AAMVNHKNKALGIIVSQQFIVQIGIFTALPMIVENSLEQGFLQAVWDFLTMQLQLSSVFYTFSMGTRSHFFGRTILHGGAKYRATGRGFVVEHKSFAENY
  RLYARSHFVKAIELGLILIVYATQSTVATDTFVYIVMTCSSWFLVASWILTPFMFNPSGFDWLKTVHDFHDFMNWIWNRQRVFAKAEQSWERWWYEEHDH
  LKLTGIWGKLLEIILDLRFFIFQYGIVYRLGIAAGSTSIAVYFLSWIYVFV
Full Sequence
Protein Sequence     Length: 1753     Download
MPNTRHHRHH VVHPYNILPL HNPTIDHPSL RFPEVRAAAA ALSSVGDLRL PPQWHPDMDL    60
LDWLGLLFGF QNDNVRNQRE HLLLHLANAQ MRLSPPQETL DAALLRSFRS KLLRNYTSWC    120
SYLAAKPAVN LSYRPANSSP SDQRRELLYV SLYLLIWGEA ANLRFLPECL SYIFHHMAKD    180
LNKFLQHHDY DNSLHQSSLH QPSFLDRVVQ PIYRILLSEV ESSRNGTVPH CEWRNYDDMN    240
EFFWDKRCFK KLKWPIDIGS GFFDKRVGKI GFVERRSFWN LFRSFHRLWV MLFLFLQAAL    300
IVAWEDKTYP WHALKDRDLQ VRVLTIFFTW SALRFFQSLL DIVMQWSRLV SVETIGLGLK    360
MILKAVVAAA WFVVFFIFYR KIWEQRRSDG NWSVEANKQL VNFLEIVFIF MIPELLALVF    420
LILPWVRNFI ENKDWCLFYV LSWWFQGRTF VGRGLSEGLM DNIRYTLFWA VVLASKFCFS    480
YFLQIRPMVP PSKMILDLKD VNYQWHELFQ NGNWFPLGLL WLPVILIYLM DIQIWYSIYS    540
SLVGVSVGLF AHLGEIRSMQ QLKLRFQFFA SAVLFNLMPE EQLLNARRTL SGKIKDAIHR    600
MKLRYGFGQP YMKLESNQSE ANKFALIWNE VIMCFREEDI ISDEEVELLE LPKNSWNVRV    660
IRWPCFLLCN ELLLALSQAK ELVDVSDKRL WRKMCKHEFR RCAVIETYDC IKHLLLQIIK    720
PNSEEHSIVM VLFQEIDHSL EIGKFTQVFK TTALPQLHNK LIKFVELLNK KQIDSSKIVN    780
TLQALYEIVV RDFFKEKRNI ERLREDGLAP QNPDSSEVLL FENAIQLPET INENFYRQIR    840
RLLTILTSRD SMQNVPVNLE ARRRITFFTN SLFMKMPHAP QVEKMMAFSV LTPYYSEEVV    900
YSKEQLRVGN EDGISTLYYL QTIYDDEWKN FMERMRREGM KNESDIWTHK LGDLRSWASY    960
RGQTLSRTVR GMMYYYKSLK LLAFLDSASE VEIREGTREL VSLNQDNSDG FSSNKSPPSP    1020
MSLSTENSSA RLLFKGHDYG TASMKFTYVI SCQIYGAQKE RKDPRAEEIL YLMKNNEALR    1080
VAYVDEVPFG SGEKEYYSVL AKYDQQLERE VEIYRVKLPG PIKLGEGKPE NQNHAIIFTR    1140
GDAVQTIDMN QDNYFEEALK MRNLLEEYRY YYGIRKPTIL GMREHIFTAF VSSLAWFMSA    1200
QEMSFVTLGQ RVLANPLKVR MHYGHPDVFD RFWFITRGGI SKASRVINIS EDIFAGFNCT    1260
LRGGNVTHHE YIQVGKGRDV GLNQVSMFEA KVASGNGEQV LSRDVYRLGH KLDFFRMLSF    1320
FYTTVGFFFN TMMVVLTVYA FLWGRLMLAL SGIEAAMVNH KNKALGIIVS QQFIVQIGIF    1380
TALPMIVENS LEQGFLQAVW DFLTMQLQLS SVFYTFSMGT RSHFFGRTIL HGGAKYRATG    1440
RGFVVEHKSF AENYRLYARS HFVKAIELGL ILIVYATQST VATDTFVYIV MTCSSWFLVA    1500
SWILTPFMFN PSGFDWLKTV HDFHDFMNWI WNRQRVFAKA EQSWERWWYE EHDHLKLTGI    1560
WGKLLEIILD LRFFIFQYGI VYRLGIAAGS TSIAVYFLSW IYVFVVFGIY VVVAYARNEY    1620
EATQHMYFRL VQTLVIVIAI LVIVALLEFT KFKFMDIFTS LVAFIPTGWG MILIAQVFRP    1680
FLQCTIVWNV VVSLARLYDI LFGIIVLTPV ALLSWLPGFQ PMQTRILFNE AFGRGLCIFQ    1740
IVTGKKSSAK SH*                                                       1800
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam14288FKS1_dom18.0e-48144257114+
pfam02364Glucan_synthase08551626842+
Gene Ontology
GO TermDescription
GO:00001481,3-beta-D-glucan synthase complex
GO:00038431,3-beta-D-glucan synthase activity
GO:0006075(1->3)-beta-D-glucan biosynthetic process
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAB84371.101317472317661,3-beta-glucan synthase component-like [Oryza sativa Japonica Group]
RefSeqNP_001044278.10111749211789Os01g0754200 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_192264.10131749261778ATGSL05 (GLUCAN SYNTHASE-LIKE 5); 1,3-beta-glucan synthase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqNP_567278.10151748201768GSL1 (GLUCAN SYNTHASE-LIKE 1); 1,3-beta-glucan synthase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002517915.10151747241767transferase, transferring glycosyl groups, putative [Ricinus communis]
Transmembrane Domains
StartEnd
285304
319336
357379
401423
463485
512529
534556
13211343
13641386
13961418
14861508
15641586
15931615
16251647
16601682
16971719
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO425519625113017490
HO78074653388514060
HO801980232118614130
HO801980172141315840
EL451457307103613420
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_056_00094.1Aquca_014_00906.1Aquca_019_00181.4Aquca_019_00181.3Aquca_019_00181.1
Aquca_016_00166.1Aquca_019_00181.2Aquca_084_00016.4Aquca_084_00016.3Aquca_084_00016.2
Aquca_084_00016.1Aquca_022_00132.2Aquca_022_00132.1Aquca_014_00908.4Aquca_014_00908.3
Aquca_014_00908.2Aquca_014_00908.1Aquca_014_00908.5Aquca_008_00266.1Aquca_039_00091.4
Aquca_039_00091.2Aquca_039_00091.1Aquca_039_00091.3Aquca_056_00094.2
Arabidopsis lyrata340908482666470669899601907409
878725482124490214490142897726
325786
Arabidopsis thalianaAT3G07160.1AT2G36850.1AT1G06490.1AT4G03550.1AT2G13680.1
AT1G05570.2AT1G05570.1AT4G04970.1AT3G59100.1AT2G31960.2
AT2G31960.1AT5G13000.1AT5G13000.2AT3G14570.2AT3G14570.1
AT5G36870.1
Brachypodium distachyonBradi1g51757.1Bradi1g77247.2Bradi1g77247.1Bradi1g47427.1Bradi2g50140.1
Bradi3g60790.2Bradi3g60790.1Bradi1g29622.1Bradi1g76617.1Bradi2g46250.1
Bradi2g40460.1Bradi3g09317.1Bradi2g40430.1
Brassica rapaBra005239Bra029628Bra001239Bra040364Bra015504
Bra034218Bra032416Bra037213Bra029541Bra015436
Bra003364Bra023386Bra008864Bra005624Bra027328
Carica papayaevm.model.supercontig_42.151evm.model.supercontig_189.7evm.model.supercontig_25.167evm.model.supercontig_858.3evm.model.supercontig_2050.2
evm.model.supercontig_3407.1evm.model.supercontig_50.100evm.model.supercontig_4.57
Capsella rubellaCarubv10022498mCarubv10022499m
Citrus clementinaCiclev10014066mCiclev10018457mCiclev10018456mCiclev10000018mCiclev10018223m
Ciclev10030477mCiclev10030476mCiclev10014015mCiclev10030481mCiclev10030478m
Ciclev10030495mCiclev10024186mCiclev10030599mCiclev10030560mCiclev10030796m
Citrus sinensisorange1.1g000946morange1.1g000813morange1.1g000382morange1.1g000253morange1.1g000219m
orange1.1g000179morange1.1g000260morange1.1g000273morange1.1g000180morange1.1g000261m
orange1.1g045737morange1.1g000259morange1.1g000258morange1.1g001004morange1.1g000585m
orange1.1g000171morange1.1g000349morange1.1g000165morange1.1g001473morange1.1g000389m
orange1.1g000385morange1.1g040336morange1.1g000763m
Cucumis sativusCucsa.157510.4Cucsa.157510.3Cucsa.157510.2Cucsa.157510.1Cucsa.142920.1
Cucsa.249900.1Cucsa.119100.1Cucsa.126670.1Cucsa.239610.1Cucsa.049980.10
Cucsa.142930.1Cucsa.049980.1Cucsa.058220.1Cucsa.058230.1
Eucalyptus grandisEucgr.B00160.1Eucgr.B03640.2Eucgr.B03640.1Eucgr.I00208.1Eucgr.K01028.4
Eucgr.K01028.3Eucgr.K01028.2Eucgr.K01028.1Eucgr.D00621.1Eucgr.A01821.1
Eucgr.K01027.1Eucgr.D00622.1Eucgr.J00836.1Eucgr.J00827.1Eucgr.F01403.1
Eucgr.A01827.1Eucgr.A02008.1Eucgr.A01817.1Eucgr.A01994.2Eucgr.A01994.1
Eucgr.A02010.1Eucgr.J00836.2Eucgr.A01997.1
Fragaria vescamrna09912.1-v1.0-hybridmrna17912.1-v1.0-hybridmrna17710.1-v1.0-hybridmrna28731.1-v1.0-hybridmrna02397.1-v1.0-hybrid
mrna24411.1-v1.0-hybridmrna26782.1-v1.0-hybridmrna28728.1-v1.0-hybrid.526.840mrna28728.1-v1.0-hybrid.526.840
Glycine maxGlyma06g18216.1Glyma04g36725.1Glyma20g38860.1Glyma10g44150.1Glyma05g32500.4
Glyma05g32500.3Glyma05g32500.2Glyma08g16660.1Glyma04g39120.2Glyma04g39120.1
Glyma13g37290.2Glyma08g42150.3Glyma08g42150.2Glyma08g42150.1Glyma18g12870.3
Glyma18g12870.2Glyma18g12870.1Glyma15g08020.3Glyma15g08020.2Glyma15g08020.1
Glyma15g42330.4Glyma15g42330.3Glyma15g42330.2Glyma18g53823.1Glyma08g47670.1
Glyma08g47670.2Glyma18g13105.9Glyma18g13105.8Glyma18g13105.7Glyma18g13105.6
Glyma18g13105.10Glyma18g13105.3Glyma18g13105.2Glyma18g13105.1Glyma18g13105.5
Glyma18g13105.4Glyma15g39420.2Glyma13g33560.1Glyma05g32500.6Glyma05g32500.5
Glyma08g42110.1Glyma06g44770.3Glyma06g44770.2Glyma13g31310.1Glyma06g44770.4
Glyma10g44150.2Glyma08g16715.1Glyma06g15860.1.320.682Glyma06g15860.1.320.682Glyma08g16730.2
Gossypium raimondiiGorai.004G018200.3Gorai.004G018200.1Gorai.004G018200.2Gorai.003G109000.6Gorai.003G109000.1
Gorai.003G109000.2Gorai.003G109000.3Gorai.003G109000.4Gorai.011G120300.1Gorai.005G201500.2
Gorai.005G201500.1Gorai.011G119900.1Gorai.013G075600.1Gorai.004G092500.3Gorai.004G092500.2
Gorai.004G092500.1Gorai.011G096900.3Gorai.011G096900.1Gorai.004G092600.3Gorai.004G092600.1
Gorai.009G169700.3Gorai.009G169700.2Gorai.009G169700.1Gorai.012G187400.3Gorai.012G187400.2
Gorai.012G187400.1Gorai.004G092600.2Gorai.004G092600.4Gorai.012G040000.2Gorai.012G040000.1
Gorai.005G042700.1Gorai.005G043100.1Gorai.012G128700.1Gorai.007G334800.1Gorai.007G334800.2
Gorai.003G109000.5
Linum usitatissimumLus10014796Lus10032463Lus10039828Lus10000266Lus10031648
Lus10033689Lus10001424Lus10001056Lus10003920Lus10039199
Lus10037469Lus10013744Lus10033483Lus10007327Lus10030030
Lus10042478Lus10020893Lus10020750Lus10040891.301.669Lus10040891.301.669
Lus10002096Lus10002097
Malus domesticaMDP0000174437MDP0000286691MDP0000245319MDP0000275961MDP0000915307
MDP0000229527MDP0000230907MDP0000203763MDP0000321472MDP0000220467
MDP0000308574MDP0000198973MDP0000230621MDP0000212172.415.839MDP0000212172.415.839
MDP0000372473MDP0000310065MDP0000213931MDP0000218486.624.863MDP0000218486.624.863
MDP0000218486.624.863
Manihot esculentacassava4.1_001919mcassava4.1_031653mcassava4.1_029201mcassava4.1_000111mcassava4.1_000342m
cassava4.1_000112mcassava4.1_000082mcassava4.1_026004mcassava4.1_002527mcassava4.1_003374m
cassava4.1_003342mcassava4.1_006866mcassava4.1_028751mcassava4.1_033421m
Medicago truncatulaMedtr4g078220.1Medtr3g047390.1Medtr7g005950.1Medtr1g116370.1AC235753_1023.1
Medtr1g116470.1.521.981Medtr1g116470.1.521.981Medtr1g116470.1.228.504Medtr1g116470.1.228.504
Mimulus guttatusmgv1a000080mmgv1a000075mmgv1a000084mmgv1a000082mmgv1a000070m
mgv1a000067mmgv1a000108mmgv1a024191mmgv1a000066mmgv1a000106m
mgv1a000068m
Oryza sativaLOC_Os06g08380.1LOC_Os02g58560.1LOC_Os01g55040.1LOC_Os06g51270.1LOC_Os03g03610.3
LOC_Os03g03610.2LOC_Os03g03610.1LOC_Os02g58560.3LOC_Os02g14900.1LOC_Os01g34930.1
LOC_Os01g48200.1LOC_Os01g34890.1LOC_Os01g34880.1
Panicum virgatumPavirv00009928mPavirv00009617mPavirv00009495mPavirv00057448mPavirv00022973m
Pavirv00045342mPavirv00015084mPavirv00020404mPavirv00041942mPavirv00010502m
Pavirv00026821mPavirv00007196mPavirv00061397mPavirv00045035mPavirv00040188m
Pavirv00056028mPavirv00049749mPavirv00048524mPavirv00058599m
Physcomitrella patensPp1s88_136V6.1Pp1s160_88V6.1Pp1s40_186V6.2Pp1s67_234V6.1Pp1s67_70V6.1
Pp1s145_49V6.1Pp1s18_300V6.2Pp1s199_13V6.1Pp1s13_132V6.1Pp1s13_432V6.1
Pp1s379_24V6.1Pp1s66_72V6.1
Phaseolus vulgarisPhvul.007G004900.2Phvul.007G004900.1Phvul.007G004900.3Phvul.002G272000.1Phvul.009G150300.2
Phvul.009G150300.1Phvul.011G113800.1Phvul.006G185600.2Phvul.006G185600.1Phvul.006G032100.1
Phvul.006G031900.1Phvul.008G002300.1Phvul.005G040900.2Phvul.007G005100.1Phvul.005G040900.1
Phvul.005G062500.1Phvul.009G169400.1
Picea abiesMA_10428413g0040MA_826577g0010MA_960362g0010MA_10426974g0030MA_735748g0010
MA_6205g0020MA_10426974g0020MA_10430560g0010MA_10431062g0010MA_229544g0010
MA_10434444g0010MA_10431631g0010
Populus trichocarpaPotri.015G089300.1Potri.001G011900.1Potri.005G058300.2Potri.005G058300.1Potri.013G131300.1
Potri.001G230000.9Potri.001G230000.8Potri.001G230000.7Potri.001G230000.6Potri.001G230000.5
Potri.001G230000.4Potri.001G230000.3Potri.001G230000.2Potri.001G230000.17Potri.001G230000.16
Potri.011G052400.6Potri.011G052400.5Potri.011G052400.4Potri.011G052400.3Potri.011G052400.2
Potri.011G052400.1Potri.002G058700.3Potri.002G058700.2Potri.002G058700.1Potri.001G012200.3
Potri.001G012200.1Potri.001G012200.2Potri.005G203500.2Potri.005G203500.1Potri.003G214200.2
Potri.003G214200.1Potri.011G095100.2Potri.011G095100.1Potri.001G230000.10Potri.001G230000.18
Potri.001G012200.5Potri.001G012200.4Potri.005G203500.3Potri.001G230000.11Potri.001G230000.12
Potri.001G230000.13
Prunus persicappa000071mppa000167mppa000077mppa000074mppa001863m
ppa000121mppa000112mppa002267mppa000073mppa003008m
ppa000306m
Ricinus communis30147.m01381228035.m00035829691.m00028229983.m00319129734.m000419
28035.m00035929759.m00028130226.m00202329983.m00319229851.m002416
Setaria italicaSi033860mSi034369mSi034352mSi008368mSi016068m
Si016067mSi000021mSi000023mSi000022mSi000017m
Si033956mSi033893mSi033872mSi016150mSi000059m
Selaginella moellendorffii133452439692163802267830177798
449402
Sorghum bicolorSb10g005550.1Sb04g038510.1Sb10g030970.1Sb01g048630.1Sb03g023490.1
Sb03g030800.1Sb03g034880.1Sb04g008830.1
Thellungiella halophilaThhalv10019878mThhalv10016126mThhalv10006529mThhalv10022518mThhalv10028360m
Thhalv10028359mThhalv10006533mThhalv10006528mThhalv10016125mThhalv10012412m
Thhalv10005734mThhalv10019876mThhalv10029222m
Vitis viniferaGSVIVT01025370001GSVIVT01007560001GSVIVT01026489001GSVIVT01001361001GSVIVT01020854001
GSVIVT01025362001GSVIVT01000622001GSVIVT01005204001GSVIVT01020548001.494.863GSVIVT01020548001.494.863
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)