y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.005G131200.1
FamilyGH29
Protein PropertiesLength: 536 Molecular Weight: 60305.6 Isoelectric Point: 6.5608
ChromosomeChromosome/Scaffold: 05 Start: 35650568 End: 35653552
Descriptionalpha-L-fucosidase 1
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH29643590
  LQWQLRDMSLFFHFGPNTFTDSEWGSGHAHPSVFNPTKLNPSQWIRVAKNCGFSTVILTVKHHDGFCLWPSDYTDYSLRSSNWKNGSGDVVAELSSAAKD
  AGVGFGIYLSPWDRHETSFGDTLRYNEFYLAQMTELLTRYGEITDVFLDGAKGEGEKDMNYLYTSWNSLIHQLQPGVSIFSDLGPETRWVGNEYGIAGFT
  CWSLFNKTGFEIGQIDLQYNSEGDPLGPDWIPATCDVSIRPGWFWHASESPMSARSLLEIYYKSVGRNCKLLLNVPPNSSGLISDEDIQVLQEFAE
Full Sequence
Protein Sequence     Length: 536     Download
MKLNKSSRSW CKPHNPLIKI STCRLPNFPI QILLLGLCHL LVPASCSRKP PPLPILPLPT    60
ALQLQWQLRD MSLFFHFGPN TFTDSEWGSG HAHPSVFNPT KLNPSQWIRV AKNCGFSTVI    120
LTVKHHDGFC LWPSDYTDYS LRSSNWKNGS GDVVAELSSA AKDAGVGFGI YLSPWDRHET    180
SFGDTLRYNE FYLAQMTELL TRYGEITDVF LDGAKGEGEK DMNYLYTSWN SLIHQLQPGV    240
SIFSDLGPET RWVGNEYGIA GFTCWSLFNK TGFEIGQIDL QYNSEGDPLG PDWIPATCDV    300
SIRPGWFWHA SESPMSARSL LEIYYKSVGR NCKLLLNVPP NSSGLISDED IQVLQEFAEL    360
RRSIFSHNLA INAVINASSI RGGIQDTHFS PYNILKEGIY TYWAPEENQT KWILYINLEE    420
LVSFNVLQLQ EPIHMGQRVI EFHLETLSQD GVWMRVVNGT TIGYQRLLLF PKLKSQYLKL    480
VVDKSRADPL ISYLGIYMDS VTVLRDTPDK KSGASFNGSQ VLQTTTHNSS LSAAM*        540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01120Alpha_L_fucos1.0e-3065359316+
smart00812Alpha_L_fucos6.0e-3197359285+
COG3669COG36693.0e-6665497451+
Gene Ontology
GO TermDescription
GO:0004560alpha-L-fucosidase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_180377.204952628496ATFUC1 (alpha-L-fucosidase 1); alpha-L-fucosidase [Arabidopsis thaliana]
Swiss-ProtQ8GW7204952628496FUCO1_ARATH RecName: Full=Alpha-L-fucosidase 1; AltName: Full=Alpha-L-fucoside fucohydrolase; AltName: Full=Alpha-1,3/4-fucosidase; Short=AtFUC1; Flags: Precursor
RefSeqXP_002276131.106052051509PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002313533.106050215457predicted protein [Populus trichocarpa]
RefSeqXP_002523703.106050664511alpha-l-fucosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ues_B05949219471A Chain A, Crystal Structure Of Alpha-1,34-Fucosidase From Bifidobacterium Longum Subsp. Infantis Complexed With Deoxyfuconojirimycin
PDB3ues_A05949219471A Chain A, Crystal Structure Of Alpha-1,34-Fucosidase From Bifidobacterium Longum Subsp. Infantis Complexed With Deoxyfuconojirimycin
PDB3mo4_B05949221473A Chain A, The Crystal Structure Of An Alpha-(1-3,4)-Fucosidase From Bifidobacterium Longum Subsp. Infantis Atcc 15697
PDB3mo4_A05949221473A Chain A, The Crystal Structure Of An Alpha-(1-3,4)-Fucosidase From Bifidobacterium Longum Subsp. Infantis Atcc 15697
PDB3uet_B05949219471A Chain A, Crystal Structure Of Alpha-1,34-Fucosidase From Bifidobacterium Longum Subsp. Infantis D172aE217A MUTANT COMPLEXED WITH LACTO-N- Fucopentaose Ii
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CX7110362722655360
FK0168952582795360
CX7080162402975360
DY270181285653490
DY300194325884100
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00507.1Aquca_062_00017.1
Arabidopsis lyrata481700
Arabidopsis thalianaAT2G28100.1
Brachypodium distachyonBradi4g35500.1Bradi5g18220.1
Brassica rapaBra034388
Carica papayaevm.model.supercontig_65.36evm.model.supercontig_3.250
Capsella rubellaCarubv10023050m
Citrus clementinaCiclev10028463m.194.266Ciclev10004832mCiclev10028210mCiclev10028463m.194.266Ciclev10028463m.51.191
Ciclev10028463m.51.191
Citrus sinensisorange1.1g011170morange1.1g047217m
Cucumis sativusCucsa.385790.1Cucsa.193300.1
Eucalyptus grandisEucgr.J00379.2Eucgr.J00379.1Eucgr.J00367.1Eucgr.A02862.1Eucgr.A02861.1
Fragaria vescamrna13375.1-v1.0-hybridmrna28904.1-v1.0-hybridmrna13376.1-v1.0-hybrid
Glycine maxGlyma12g30151.1Glyma13g39750.2Glyma10g38670.2Glyma20g29080.1Glyma10g38670.1
Gossypium raimondiiGorai.004G231200.1Gorai.008G282700.1
Linum usitatissimumLus10016140Lus10027390Lus10031681Lus10021427
Malus domesticaMDP0000166406MDP0000271120MDP0000917175MDP0000295518
Manihot esculentacassava4.1_032976mcassava4.1_006636mcassava4.1_007875mcassava4.1_021316m
Medicago truncatulaMedtr1g102230.1Medtr2g095700.1
Mimulus guttatusmgv1a004219mmgv1a005268m
Oryza sativaLOC_Os09g34920.1LOC_Os04g47280.1
Panicum virgatumPavirv00068426mPavirv00016802mPavirv00061161m
Physcomitrella patensPp1s55_131V6.2Pp1s55_131V6.1
Phaseolus vulgarisPhvul.007G063900.1
Picea abiesMA_16736g0010MA_171759g0010MA_8122188g0010
Populus trichocarpaPotri.015G133500.1Potri.009G006900.1Potri.012G131400.1
Prunus persicappa023537mppa005337m
Ricinus communis30147.m01415529589.m001240
Setaria italicaSi009874mSi029623m
Selaginella moellendorffii103164236749.37.121236749.37.121415432412246
236951112167158775103375431829
236749.167.333236749.167.333431838103154
Sorghum bicolorSb06g025200.1Sb02g030220.1
Thellungiella halophilaThhalv10016493mThhalv10016468m
Vitis viniferaGSVIVT01018468001.39.381GSVIVT01018468001.39.381GSVIVT01018468001.542.842GSVIVT01018468001.542.842GSVIVT01031495001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)