y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.005G132400.1
FamilyGT4
Protein PropertiesLength: 448 Molecular Weight: 50563.1 Isoelectric Point: 7.3131
ChromosomeChromosome/Scaffold: 05 Start: 35853700 End: 35860062
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT42023406.9e-36
  EIVIVVISRLVYRKGVDLLVEVIPEVCRLHPNVRFIIGGDGPKRVRLEEMREKHSLQDRVEMLGAVQHVQVRSVLISGHIFLNSSLTEAFCIAILEAASC
  GLLTVSTRVGGVPEVLPDEMVVLAEPDPGDMVHAIQKAI
Full Sequence
Protein Sequence     Length: 448     Download
MMMGDHQKHR ILMVSDFFYP NFGGVENHIY YLSQCLLKLG HKVVVATHAY GNRSGVRYMT    60
GGLKVYYVPW RPFVMQNTLP TIYGLLPIIR TILIRERITV LHGHQAFSTF CHEALMHART    120
MGYKVVFTDH SLYGFADVGS IHMNKVLQFT LADVSQAICV SHTSKENTVL RSGLPPEKVF    180
VVPNAVDTAI FKPAVNRPSG PEIVIVVISR LVYRKGVDLL VEVIPEVCRL HPNVRFIIGG    240
DGPKRVRLEE MREKHSLQDR VEMLGAVQHV QVRSVLISGH IFLNSSLTEA FCIAILEAAS    300
CGLLTVSTRV GGVPEVLPDE MVVLAEPDPG DMVHAIQKAI SMLPKIDPQV MHNRMRELYN    360
WHDVAKRTEI VYDRALKCSN QNLLERLSRY LFCGAWAGKL FCLVMIVGFL LWQLLELWQP    420
VDDIEEVPDF SLPHNCDEDM LEENPAK*                                       480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam08288PIGA1.0e-394813790+
COG0438RfaG2.0e-4310377386+
cd03798GT1_wlbH_like7.0e-5511375379+
cd03801GT1_YqgM_like2.0e-6910372383+
cd03796GT1_PIG-A_like010405398+
Gene Ontology
GO TermDescription
GO:0006506GPI anchor biosynthetic process
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAH01229.10243422454unnamed protein product [Oryza sativa Japonica Group]
RefSeqNP_566874.1034351433SETH2; transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002279568.1034381437PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002461824.1024341433hypothetical protein SORBIDRAFT_02g008800 [Sorghum bicolor]
RefSeqXP_002529442.1034391436glycosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3oka_B0.00000000383174318A Chain A, Crystal Structure Of Corynebacterium Glutamicum Pimb' In Complex With Gdp-Man (Triclinic Crystal Form)
PDB3oka_A0.00000000383174318A Chain A, Crystal Structure Of Corynebacterium Glutamicum Pimb' In Complex With Gdp-Man (Triclinic Crystal Form)
PDB3okp_A0.00000000483174318A Chain A, Crystal Structure Of Corynebacterium Glutamicum Pimb' In Complex With Gdp-Man (Triclinic Crystal Form)
PDB3okc_A0.00000000483174318A Chain A, Crystal Structure Of Corynebacterium Glutamicum Pimb' Bound To Gdp (Orthorhombic Crystal Form)
PDB2jjm_L0.0000000051935723359A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
Transmembrane Domains
StartEnd
390412
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE59222822522260
EE5922282162194340
GO8543913151164300
DY29594830763120
DN7954682621123730
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00305.1Aquca_053_00022.3Aquca_053_00022.2Aquca_053_00022.1
Arabidopsis lyrata860579323188
Arabidopsis thalianaAT5G01220.1AT3G45100.2AT3G45100.1
Brachypodium distachyonBradi1g59860.1Bradi2g02800.1Bradi1g67200.1Bradi1g32610.1
Brassica rapaBra009633Bra005694Bra009589
Carica papayaevm.model.supercontig_163.3evm.model.supercontig_65.21
Capsella rubellaCarubv10000742mCarubv10019008m
Chlamydomonas reinhardtiiCre01.g038550.t1.3Cre16.g689150.t1.2Cre01.g006800.t1.3
Citrus clementinaCiclev10011473mCiclev10001141mCiclev10001076m
Citrus sinensisorange1.1g022615morange1.1g017114morange1.1g016648morange1.1g009759morange1.1g027511m
Cucumis sativusCucsa.176160.1Cucsa.143020.1
Eucalyptus grandisEucgr.A00516.1Eucgr.J00902.1
Fragaria vescamrna18817.1-v1.0-hybridmrna24819.1-v1.0-hybrid
Glycine maxGlyma03g14200.1Glyma01g27840.1Glyma18g42540.1Glyma07g17680.4Glyma07g17680.3
Glyma07g17680.2Glyma07g17680.1Glyma20g12140.9Glyma20g12140.8Glyma20g12140.7
Glyma20g12140.6Glyma20g12140.5Glyma20g12140.4Glyma20g12140.3Glyma20g12140.2
Glyma20g12140.10Glyma13g25060.1
Gossypium raimondiiGorai.012G112200.2Gorai.012G112200.1Gorai.002G261700.2Gorai.002G261700.6Gorai.002G261700.4
Gorai.002G261700.3Gorai.002G261700.1Gorai.003G143800.9Gorai.003G143800.8Gorai.003G143800.7
Gorai.003G143800.6Gorai.003G143800.5Gorai.003G143800.4Gorai.003G143800.3Gorai.003G143800.2
Gorai.003G143800.10Gorai.003G143800.1
Linum usitatissimumLus10004832Lus10002499Lus10024892Lus10022925
Malus domesticaMDP0000899469MDP0000143617MDP0000297386MDP0000273680MDP0000203472
MDP0000184748MDP0000198677
Manihot esculentacassava4.1_007989mcassava4.1_005643mcassava4.1_032287m
Medicago truncatulaMedtr4g015260.1Medtr7g067340.1
Mimulus guttatusmgv1a004620mmgv1a004551mmgv1a006150mmgv1a006148m
Oryza sativaLOC_Os01g04920.1LOC_Os07g01030.1LOC_Os03g15840.1LOC_Os07g16960.1
Panicum virgatumPavirv00011082mPavirv00023556mPavirv00064963mPavirv00000330mPavirv00022111m
Pavirv00063251mPavirv00030308mPavirv00006595mPavirv00056553mPavirv00006877m
Physcomitrella patensPp1s24_194V6.1Pp1s106_103V6.1
Phaseolus vulgarisPhvul.010G005100.1Phvul.008G106900.1Phvul.002G226400.1
Picea abiesMA_158718g0080MA_60607g0010MA_159042g1330MA_159118g0680MA_159090g0090
MA_159042g1140
Populus trichocarpaPotri.016G112600.4Potri.016G112600.3Potri.016G112600.2Potri.016G112600.1Potri.006G097600.3
Potri.006G097600.2Potri.006G097600.1Potri.016G130000.1
Prunus persicappa004263mppa005676mppa018035m
Ricinus communis35899.m00002429969.m00027234675.m00002848584.m00001330418.m000015
32791.m00002229638.m00053127698.m000067
Setaria italicaSi020690mSi001496mSi035897mSi035683m
Selaginella moellendorffii170091406541
Sorghum bicolorSb02g000240.1Sb03g006480.1Sb01g040150.1Sb02g008800.1
Thellungiella halophilaThhalv10013276mThhalv10002532m
Vitis viniferaGSVIVT01033998001GSVIVT01024777001
Volvox carteriVocar20009459mVocar20001320m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)