y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.005G149100.2
FamilyGH127
Protein PropertiesLength: 858 Molecular Weight: 96167.6 Isoelectric Point: 8.6663
ChromosomeChromosome/Scaffold: 05 Start: 37657376 End: 37663216
DescriptionPutative glycosyl hydrolase of unknown function (DUF1680)
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1273496308.9e-22
  YEVTGDPLYKEIGTFFMDLVNSSHTYATGGTSVGEFWSDPKRIGDTLESTDNEESCTTYNMLKVSRHLFRWSKKVSYADYYERALTNGVLSIQRGTEPGV
  MIYMLPQGRGVSKAKTSLGWGTKFDSFWCCYGTGIESFSKLGDSIYFEEGGKNPTLYIIQYISSLFNWKSGQIIVNQTVVPAVSWDPFLRVSFTFSPAKK
  TGALSTINLRLPTWTHKDGAKGVLNNESLSLPTPGNFLSITRKWNAGDKLSLQFPMTLRTEAIKDDRSQYASIQAILYGPYV
Full Sequence
Protein Sequence     Length: 858     Download
MAFLFAFVAI VLWGSAEGKE CTNNIAQSHT YRYQLLTSMN ETWNIISHYN LAPKGDHDHI    60
WADLVPRKLL KEEYQHDWDV MLRKIEKVGV LKAPHQRQDF LKQVSLHDVR LHEGSVHARA    120
QQTNLEYLLM LDVDRLLWSF RNTAGLPTPG TPYGGWEDPK IELRGHFVGH YLSASALMWA    180
STHNDRLKKK MSALVANLSI CQEKIGTGYL SAFPSEFFDR FEATEHVWAP YYTIHKILAG    240
LLDQHSIARN PQALNMVKWM VDYFYNRVQN VITKFSISRH YQSLNEETGG MNDVLYKLYS    300
ITGDQRHLLL AHLFDKPCFL GLLAVKANDI ANFHANTHIP VVVGSQMRYE VTGDPLYKEI    360
GTFFMDLVNS SHTYATGGTS VGEFWSDPKR IGDTLESTDN EESCTTYNML KVSRHLFRWS    420
KKVSYADYYE RALTNGVLSI QRGTEPGVMI YMLPQGRGVS KAKTSLGWGT KFDSFWCCYG    480
TGIESFSKLG DSIYFEEGGK NPTLYIIQYI SSLFNWKSGQ IIVNQTVVPA VSWDPFLRVS    540
FTFSPAKKTG ALSTINLRLP TWTHKDGAKG VLNNESLSLP TPGNFLSITR KWNAGDKLSL    600
QFPMTLRTEA IKDDRSQYAS IQAILYGPYV LAGHTTGDWD IKAAPNASIE DWITPIPASY    660
NSQLFYFSQA FANSTYVLTN SNHPLAMQKL PVPGTDLALH ATFRVIPGKS ATKFTTLTDA    720
VGKTVMLEPY DHPGMRVIHQ GMEHPLTVAG SSSGCSSCVF VVVPGLDGRK ETISLESKSY    780
NGCFVHSGLH SGRGVKLSCK TSSDATFKES ASFFGKRGIS KYNPISFVAR GANKNFLLEP    840
LLAFRDESYT PYFNIKG*                                                  900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3533COG35339.0e-6999638550+
pfam07944DUF16801.0e-157108632533+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_196799.101985625860catalytic [Arabidopsis thaliana]
RefSeqXP_002283032.101285792940PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002285548.10485610863PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002297785.1018571858predicted protein [Populus trichocarpa]
RefSeqXP_002304762.101985620857predicted protein [Populus trichocarpa]
Signal Peptide
Cleavage Site
18
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7810924084318370
FE6817102534717230
HO8032952494537010
GO8434393523016520
HO781092218368563.3
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00256.1Aquca_009_00257.1
Arabidopsis lyrata350453909245488069
Arabidopsis thalianaAT5G12960.1AT5G12950.1
Brachypodium distachyonBradi1g36027.1
Brassica rapaBra006171Bra023384
Carica papayaevm.model.supercontig_84.84evm.model.supercontig_84.86
Capsella rubellaCarubv10000417mCarubv10000198m
Citrus clementinaCiclev10014240mCiclev10018011mCiclev10004509mCiclev10014230m
Citrus sinensisorange1.1g002872morange1.1g005721morange1.1g007445morange1.1g002940morange1.1g007459m
orange1.1g010393morange1.1g007406morange1.1g002978morange1.1g002973morange1.1g043003m
orange1.1g006861m
Cucumis sativusCucsa.065400.2Cucsa.065400.1
Eucalyptus grandisEucgr.B03672.1Eucgr.B03675.1Eucgr.B03677.1
Fragaria vescamrna20619.1-v1.0-hybrid
Glycine maxGlyma12g05980.1Glyma11g14020.2Glyma11g14020.1
Malus domesticaMDP0000306372MDP0000208326MDP0000125504
Manihot esculentacassava4.1_001514m
Medicago truncatulaMedtr4g065150.1
Mimulus guttatusmgv1a002509mmgv1a001146m
Oryza sativaLOC_Os02g10190.1LOC_Os06g41020.1
Panicum virgatumPavirv00026390m
Physcomitrella patensPp1s60_268V6.1
Phaseolus vulgarisPhvul.011G057700.2Phvul.011G057700.1Phvul.011G057700.3Phvul.011G057800.1Phvul.005G149100.1
Populus trichocarpaPotri.003G206000.2Potri.T087500.1Potri.003G206000.4Potri.003G206000.3Potri.003G206000.1
Potri.001G018200.1
Prunus persicappa001713m
Setaria italicaSi005995mSi016279mSi005830mSi016278m
Selaginella moellendorffii3065089765
Sorghum bicolorSb10g024070.1Sb04g006520.1
Thellungiella halophilaThhalv10012662m
Vitis viniferaGSVIVT01025310001GSVIVT01025321001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny