y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.005G158700.1
FamilyGH35
Protein PropertiesLength: 710 Molecular Weight: 80183.3 Isoelectric Point: 7.5344
ChromosomeChromosome/Scaffold: 05 Start: 38424979 End: 38436197
Descriptionbeta-galactosidase 17
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35753990
  FWRDGEPFQIIGGDVHYFRVHPEYWEDRLLKAKALGLNTIQTYVPWNLHEPAAGKFVFEGFANIEAFLNLCHKLGLLVMIRPGPYICAEWDWGGFPGWFY
  SMNPTPRLRSSDPTYLQLVERWWGNLLPKFLPLLYYNGGPIIMVQIENEFGSYGDDKAYLHHLVTLARGHLGHDVILYTTDGGVRENLEKGSIRGDAVFT
  AVDFSTGDDPWPIFKLQKEFNAPGKSPPLSAEFYTGWLTHWGEKIATTDANLTAAALENILQKNGSAVLYMAHGGTNFGFYNGANTGVDEADYKPDLTSY
  DYDAPIRESGDVDNSKFNDIRRVIA
Full Sequence
Protein Sequence     Length: 710     Download
MKIRSKKSCG EASKLVAMAK KGSSKTTIFF IFISFILFCA ILPVFAPLPS FHSHSSHHSH    60
RNTVNRKFEI ASDRFWRDGE PFQIIGGDVH YFRVHPEYWE DRLLKAKALG LNTIQTYVPW    120
NLHEPAAGKF VFEGFANIEA FLNLCHKLGL LVMIRPGPYI CAEWDWGGFP GWFYSMNPTP    180
RLRSSDPTYL QLVERWWGNL LPKFLPLLYY NGGPIIMVQI ENEFGSYGDD KAYLHHLVTL    240
ARGHLGHDVI LYTTDGGVRE NLEKGSIRGD AVFTAVDFST GDDPWPIFKL QKEFNAPGKS    300
PPLSAEFYTG WLTHWGEKIA TTDANLTAAA LENILQKNGS AVLYMAHGGT NFGFYNGANT    360
GVDEADYKPD LTSYDYDAPI RESGDVDNSK FNDIRRVIAR YTSVPLPSVP SNNEKARYGP    420
IHLQRKAFLF DTLDFTNSTN VFESETPMPM EYVGQLFGFV LYVTEYRAKR GGRILFIPKL    480
HDRAQVFISC PSEENGARPT YVGTIERWLN NKLSLPDVKC HSKTNLFILV ENMGRINYGA    540
FIFDRKGILS SVYLDGEKVK GWKMFPIPLH NLNEMSTYNP ITQASYSAFS EITSSRKKLI    600
YKHENTSKEP AFYSGHFSID KSSQVMDTFI SVSNWGKGIV FVNNFNIGRY WPLRGPQCNL    660
YVPAPLLKQG DNSLVILELE SPDPELVVHT VDEPDFTCGS SGMSLHQLK*               720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02449Glyco_hydro_428.0e-697230156+
COG1874LacA2.0e-3271386350+
PLN03059PLN030593.0e-3878395327+
pfam01301Glyco_hydro_353.0e-14775401327+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABD28499.102177081492Galactose-binding like [Medicago truncatula]
EMBLCBI35958.101370520707unnamed protein product [Vitis vinifera]
RefSeqNP_565051.106470859697BGAL17 (beta-galactosidase 17); beta-galactosidase/ catalytic/ cation binding [Arabidopsis thaliana]
RefSeqXP_002280228.10187051683PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002327549.10667081643predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3thd_D0617012624A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB3thd_C0617012624A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB3thd_B0617012624A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB3thd_A0617012624A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB3thc_D0617012624A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
Transmembrane Domains
StartEnd
2850
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO9796762424677080
CO0913062871484340
GO0302492634467060
CX7090152344757080
DY905780282673480
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_020_00429.1
Arabidopsis lyrata877397
Arabidopsis thalianaAT1G72990.2AT1G72990.1
Brachypodium distachyonBradi2g18440.2Bradi2g18440.3
Brassica rapaBra003861
Carica papayaevm.model.supercontig_1398.1evm.model.supercontig_25.44
Capsella rubellaCarubv10022320m
Citrus clementinaCiclev10024990mCiclev10024996m
Citrus sinensisorange1.1g011205morange1.1g006708morange1.1g006713morange1.1g006715morange1.1g006845m
orange1.1g007259morange1.1g009269morange1.1g011211m
Cucumis sativusCucsa.341150.1
Eucalyptus grandisEucgr.J02679.1Eucgr.J02852.1
Fragaria vescamrna23038.1-v1.0-hybrid
Glycine maxGlyma13g42560.1Glyma13g42560.2
Gossypium raimondiiGorai.008G075700.1Gorai.008G075700.2Gorai.009G141300.1Gorai.009G141300.2Gorai.009G141300.3
Linum usitatissimumLus10015616Lus10037634
Malus domesticaMDP0000944874MDP0000921848
Manihot esculentacassava4.1_026281mcassava4.1_034020m
Medicago truncatulaMedtr2g100000.1
Mimulus guttatusmgv1a002369m
Oryza sativaLOC_Os05g46200.2LOC_Os05g46200.1LOC_Os05g46200.3
Panicum virgatumPavirv00010551mPavirv00046579m
Physcomitrella patensPp1s149_266V6.1Pp1s52_244V6.1Pp1s52_244V6.2
Picea abiesMA_775331g0010MA_8535581g0010
Populus trichocarpaPotri.003G040000.1Potri.003G037000.1
Prunus persicappa002232m
Ricinus communis28694.m000663.153.29928694.m000663.153.29928694.m000663.62.15328694.m000663.62.153
Setaria italicaSi021395mSi021403m
Selaginella moellendorffii61485
Sorghum bicolorSb09g026870.1
Thellungiella halophilaThhalv10018211m
Vitis viniferaGSVIVT01016865001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny