y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.005G172300.2
FamilyGT4
Protein PropertiesLength: 702 Molecular Weight: 78259.1 Isoelectric Point: 10.6519
ChromosomeChromosome/Scaffold: 05 Start: 39559766 End: 39564127
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT45446701.1e-22
  KLLIGSVGSKSNKADYVKSLLNFLEQHPNTSKSIFWTPATTRVASLYSAADVYVINSQGLGETFGRVTIEAMAFGLPVLGTEAGGTKEIVEHNVTGLLHP
  VGHPGNLVLAQNLRFLLKNQLARKQMG
Full Sequence
Protein Sequence     Length: 702     Download
MEESINRGEF QPNLAKQTSL RLGGSFKSTL SGRSTPRNSP SFRRQNSGRT PRKEGRSGIG    60
GALWFRSNRL LFWLLLITLW AYLGFFVQSR WAHSDKKEEF SGFGTGPRNT GSDAEQVQRR    120
DLLASDHSLS ANNETDANIA LSSKTINVVL AKRGNDVPSH RKTSSKKRSR RRRASKGKSS    180
GKLKPSTDVK DADIEEQKPE IPTANGTYGL LVGPFGPVED RILEWSPEKR SGTCNRKGDF    240
ARLVWSRRFI LVFHELSMTG APLSMMELAT ELLSCGATVS AVVLSKKGGL MSELARRRIK    300
VLEDKADLSF KTAMKADLVI AGSAVCASWI DQYIERFPAG ASQVVWWIME NRREYFDLSK    360
DALDRVKMLV FLSESQSKQW LKWCEEESIK LRSYPEIIPL SVNDELAFVA GIPSTLNTPS    420
FSTDKMVEKR QLLRESVRKE IGLNDSDMLV ISLSSINPGK GQLLLLESVS SVLEQGWLQD    480
DKKMKKVSNI KEGISTLARK HRIRKLLPVL KNGKVVSNDI SSNSLSRRKQ VLPDDKGTIQ    540
KSLKLLIGSV GSKSNKADYV KSLLNFLEQH PNTSKSIFWT PATTRVASLY SAADVYVINS    600
QGLGETFGRV TIEAMAFGLP VLGTEAGGTK EIVEHNVTGL LHPVGHPGNL VLAQNLRFLL    660
KNQLARKQMG VEGRKKVQQM YLKQHMYKKF VEVIVRCMRS K*                       720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0438RfaG2.0e-18543701160+
cd03798GT1_wlbH_like2.0e-18585693109+
cd03800GT1_Sucrose_synthase1.0e-1858568197+
cd03808GT1_cap1E_like5.0e-22543692150+
cd03801GT1_YqgM_like1.0e-25586694109+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN71826.1017011734hypothetical protein [Vitis vinifera]
EMBLCBI36173.1017011683unnamed protein product [Vitis vinifera]
RefSeqXP_002284822.10157014691PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002298139.1017011681predicted protein [Populus trichocarpa]
RefSeqXP_002528176.1017011686glycosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2jjm_L0.00000006586699278387A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_K0.00000006586699278387A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_J0.00000006586699278387A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_I0.00000006586699278387A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_H0.00000006586699278387A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
Transmembrane Domains
StartEnd
7092
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FE7096452921073980
HS0643982481854320
FG1474092582054620
EY8095232442094520
FF3948332414366760
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00577.1Aquca_001_00590.2Aquca_001_00590.1
Arabidopsis lyrata889408316473897892474368
Arabidopsis thalianaAT1G19710.1AT1G75420.1AT3G15940.2AT3G15940.1AT1G52420.1
Brachypodium distachyonBradi2g09620.1
Brassica rapaBra025759Bra027200Bra030384
Carica papayaevm.model.supercontig_99.5evm.model.supercontig_253.2
Capsella rubellaCarubv10020237mCarubv10011399mCarubv10013095m
Citrus clementinaCiclev10025538mCiclev10001031mCiclev10024994m
Citrus sinensisorange1.1g023290morange1.1g017123morange1.1g017085morange1.1g012132morange1.1g011954m
orange1.1g004942morange1.1g004760m
Cucumis sativusCucsa.105340.1Cucsa.300870.1
Eucalyptus grandisEucgr.F01601.1Eucgr.F03009.1Eucgr.J03011.1
Fragaria vescamrna15198.1-v1.0-hybridmrna14930.1-v1.0-hybridmrna05979.1-v1.0-hybrid
Glycine maxGlyma04g03170.1Glyma06g03220.1Glyma15g01640.6Glyma15g01640.5Glyma15g01640.4
Glyma15g01640.3Glyma08g22160.2Glyma07g03870.1Glyma13g43720.1
Gossypium raimondiiGorai.009G198800.1Gorai.003G012600.2Gorai.003G012600.1Gorai.007G199800.4Gorai.007G199800.3
Gorai.007G199800.1Gorai.009G132600.4Gorai.009G132600.3Gorai.009G132600.2Gorai.009G132600.1
Gorai.002G058400.1Gorai.011G077500.1
Linum usitatissimumLus10041786Lus10028338Lus10024281Lus10011469Lus10037523
Malus domesticaMDP0000210114MDP0000312093MDP0000064350MDP0000204168
Manihot esculentacassava4.1_006962mcassava4.1_006727mcassava4.1_002537m
Medicago truncatulaMedtr4g069840.1
Mimulus guttatusmgv1a005641mmgv1a002407m
Oryza sativaLOC_Os01g15780.1
Panicum virgatumPavirv00028369m
Physcomitrella patensPp1s24_249V6.3
Phaseolus vulgarisPhvul.009G060600.1Phvul.010G151400.1Phvul.005G172300.1
Picea abiesMA_159042g1120
Populus trichocarpaPotri.005G118800.1Potri.002G031300.1Potri.001G179000.1Potri.001G179000.5
Prunus persicappa005334mppa005118mppa002059m
Ricinus communis30170.m01409429872.m00052635599.m00001450675.m000024
Setaria italicaSi002128m
Selaginella moellendorffii10326098243
Sorghum bicolorSb03g010200.1
Thellungiella halophilaThhalv10007567mThhalv10007509mThhalv10018489mThhalv10020188mThhalv10011288m
Thhalv10011286m
Vitis viniferaGSVIVT01009775001GSVIVT01018875001GSVIVT01017132001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)