y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.005G184400.1
FamilyCE8
Protein PropertiesLength: 355 Molecular Weight: 39386.6 Isoelectric Point: 7.8565
ChromosomeChromosome/Scaffold: 05 Start: 40476952 End: 40478321
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE8613370
  VIVSKDGNGDYRTVGEAILKAPEMSEKPYTIHVRAGTYQEYLFIPPHKTNIRLLGDGPHLTKIVAYQKGSTLDIRGDGFMAVKMGFANWAGLNASGAVAI
  RNEADKSIFYQCSIEGLQDTLWAVSGRQFYKRCAIYGTVDFIYGNAAAAFQDCMLYARYREYVTFTAQSREDPNEKTGFSFQRCEFRMSPQDESRKREVH
  ASLGRPLRAYSTVAILHSYIDSVVDPEGWEPMPHQPTNKVTYIEFHNTGPGSNTDGRVKWAGGHPAQAARFTASSLL
Full Sequence
Protein Sequence     Length: 355     Download
MECREVNVVS TEPVIYIYID TERKKMVGAL RGLTMESAKS AVLVIFCSVW LWRVQGGSGS    60
VIVSKDGNGD YRTVGEAILK APEMSEKPYT IHVRAGTYQE YLFIPPHKTN IRLLGDGPHL    120
TKIVAYQKGS TLDIRGDGFM AVKMGFANWA GLNASGAVAI RNEADKSIFY QCSIEGLQDT    180
LWAVSGRQFY KRCAIYGTVD FIYGNAAAAF QDCMLYARYR EYVTFTAQSR EDPNEKTGFS    240
FQRCEFRMSP QDESRKREVH ASLGRPLRAY STVAILHSYI DSVVDPEGWE PMPHQPTNKV    300
TYIEFHNTGP GSNTDGRVKW AGGHPAQAAR FTASSLLDAD SWIPSTGVPY HTGL*         360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02488PLN024881.0e-8361354311+
PLN02468PLN024682.0e-8461354311+
PLN02713PLN027134.0e-8925354357+
PLN02314PLN023144.0e-9061354314+
pfam01095Pectinesterase4.0e-11161340297+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN76835.1060354186497hypothetical protein [Vitis vinifera]
EMBLCAN83663.1060354201512hypothetical protein [Vitis vinifera]
EMBLCBI24285.1060354133444unnamed protein product [Vitis vinifera]
RefSeqXP_002264156.1060354202513PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002265599.1060354201512PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1xg2_A0603544315B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1gq8_A0603548319A Chain A, Pectin Methylesterase From Carrot
PDB2ntq_B0.0000000000000067134518340A Chain A, Pectin Methylesterase From Carrot
PDB2ntq_A0.0000000000000067134518340A Chain A, Pectin Methylesterase From Carrot
PDB2ntp_B0.0000000000000067134518340A Chain A, Pectin Methylesterase From Carrot
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FF397353237302660
HO778758311613540
HO852920314583550
DY948282284893550
DR100880275853430
Orthologous Group
SpeciesID
Glycine maxGlyma15g00400.2
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny