y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.006G032100.1
FamilyGT48
Protein PropertiesLength: 1918 Molecular Weight: 223518 Isoelectric Point: 8.0542
ChromosomeChromosome/Scaffold: 06 Start: 13362461 End: 13396975
Descriptionglucan synthase-like 7
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT48104017700
  VPQNIEARRRITFFANSLFMNMPKAPKVRDMLSFSVLTPYFKEDVLYSDEELNKENEDGISILFYLTKIYPDEWANFHERLKSEDSEEEKEELMRQWASY
  RGQTLYRTVRGMMYYWHALILQCFIESAGDNALSEGYRTMYSYDTNKKLLEEAQAMADLKFTYVVSCQVYGSQKKSKNPRDRSCYNNILNLMLTNTALRV
  AYIDETEETKDGKSQKVYYSVLVKGGDKYDEEIYRIKLPGPPTEIGEGKPENQNHAIIFTRGEALQTIDMNQDNYYEEAFKMRNVLEEFRKRRTGRRKPT
  ILGIREHIFTGSVSSLAWFMSNQETSFVTIGQRILANPLRVRFHYGHPDIFDRMFHITRGGLSKASKVINLSEDIFAGFNSTLRQGFITHHEYIQVGKGR
  DVGMNQISLFEAKVANGNGEQSLSRDVYRLGRRFDFYRMLSFYFTTVGFYFSSMITVLTVYVFLYGRLYMVLSGVEKEILQSPNIHQSKALEEALATQSV
  VQLGLLLVLPMVMEIGLEKGFRTALGDFIIMQLQLASVFFTFQLGTKAHYYGRTLLHGGSKYRPTGRGFVVFHAKFAENYRMYSRSHFVKGLEILILLIV
  YEVYGESYRSSHLYLFITISMWFLATSWLFAPFLFNPSGFDWQKTVDDWSDWKRWMGNRGGIGISADKSWESWWDEENEHMKHSNIRGKILEIILAFRFF
  MYQYGIVYHMDITHHNKELLVFGLSWAVLII
Full Sequence
Protein Sequence     Length: 1918     Download
MASTSGTKTP FEIGRQPSKK IMRAPTRNVD LGNEEGVVDS EIVPSSLAVL VPILRAALEI    60
EEENPRVAYL CRFHAFEKAH TMDPTSSGRG VRQFKTYLLH KLEKEGELTE KLVQRSDARE    120
LQTYYQHFYE KKIRDGEFSQ RPEEMAKNVQ IATVLYEVLK TMVAPPNIEE KTKRYAEDVE    180
HKRGQYEHYN ILPLYAVGVR PAIMELPEIK AAILALSKVD NLPMPIIRAR PDASNDDYTT    240
PTDRLKKVND ILDWIASVFG FQKGNVANQR EHLILLLANL NIRDRVESSS QLHVETIEKL    300
MRTIFKNYES WCHYVRCESN LRFLEDYDLE QIELIYIALY LLIWGEASNI RFMPECICYI    360
FHHMCHEVYR ILDKNPSRVT GSTELVEGRD DEYFLREVIS PIYQVLMKEA KRNNKGKASH    420
SNWRNYDDLN EYFWSKKCFE DLKWPWDPKA DFFRHSDETQ TRHRRRSQAN TGVGKRKPKT    480
NFVEVRTFLH LYRSFDRMWI FFILALQAMI IIGWSSLGPV GVFFDEDVFR NVMTIFITYA    540
FLNFLQVTLD IILTWNALKN MKFTQLLRYF LKFVVAAVWV VVLPICYSSS LVNPSGLIKF    600
VTSWAGDWGP QSLYTYVVVL YMCPNIVGTI LFFIPPLRRK LERSNMRILT ILMWWAQPKL    660
YVGRGMHENM FSLLKYTLFW IMLLISKLAF SYYVEILPLI GPTKLIMGMS INNYQWHEFF    720
PENETHNICI VIAIWAPIIL VYFMDTQIWY AIYATLFGGI IGAFSHLGEI RTLGMLRSRF    780
QSVPVAFSQR FWTGRDRKTK QEESDETYER NNIAYFSQVW NEFINSMREE DLISNRDRDL    840
LLVPYTASYV SVIQWPPFLL ASKIPIAVDM AKDYKKETDD DLFRKIKSDG YMYSAVVECY    900
ETLREIILHL LLEEEDKLVV SSICDKVEQC IREETFVKEF NMTGLPSLSE KLEKFLTLLR    960
SEDGKLESQI VNVLQDIVEI IIQDVMVDGH LFLQTPQQYH LERGQRFVNV DTSFTHNRAV    1020
MEKVIRLHLL LTVKESAINV PQNIEARRRI TFFANSLFMN MPKAPKVRDM LSFSVLTPYF    1080
KEDVLYSDEE LNKENEDGIS ILFYLTKIYP DEWANFHERL KSEDSEEEKE ELMRQWASYR    1140
GQTLYRTVRG MMYYWHALIL QCFIESAGDN ALSEGYRTMY SYDTNKKLLE EAQAMADLKF    1200
TYVVSCQVYG SQKKSKNPRD RSCYNNILNL MLTNTALRVA YIDETEETKD GKSQKVYYSV    1260
LVKGGDKYDE EIYRIKLPGP PTEIGEGKPE NQNHAIIFTR GEALQTIDMN QDNYYEEAFK    1320
MRNVLEEFRK RRTGRRKPTI LGIREHIFTG SVSSLAWFMS NQETSFVTIG QRILANPLRV    1380
RFHYGHPDIF DRMFHITRGG LSKASKVINL SEDIFAGFNS TLRQGFITHH EYIQVGKGRD    1440
VGMNQISLFE AKVANGNGEQ SLSRDVYRLG RRFDFYRMLS FYFTTVGFYF SSMITVLTVY    1500
VFLYGRLYMV LSGVEKEILQ SPNIHQSKAL EEALATQSVV QLGLLLVLPM VMEIGLEKGF    1560
RTALGDFIIM QLQLASVFFT FQLGTKAHYY GRTLLHGGSK YRPTGRGFVV FHAKFAENYR    1620
MYSRSHFVKG LEILILLIVY EVYGESYRSS HLYLFITISM WFLATSWLFA PFLFNPSGFD    1680
WQKTVDDWSD WKRWMGNRGG IGISADKSWE SWWDEENEHM KHSNIRGKIL EIILAFRFFM    1740
YQYGIVYHMD ITHHNKELLV FGLSWAVLII ILIVLKMVSM GRRRFGTDFQ LMFRILKALL    1800
FLGFLSVMTV LFVVCGLTIS DLFAAIIAFM PSGWAIILIA QACKVCLKGA KLWDSVKELS    1860
RAYEYVMGLI IFLPTAILSW FPFVSEFQTR LLFNQAFSRG LQISMILAGK KDTYKSD*      1920
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam14288FKS1_dom12.0e-48344447104+
pfam02364Glucan_synthase010401751792+
Gene Ontology
GO TermDescription
GO:00001481,3-beta-D-glucan synthase complex
GO:00038431,3-beta-D-glucan synthase activity
GO:0006075(1->3)-beta-D-glucan biosynthetic process
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_191469.202191631931ATGSL11 (glucan synthase-like 11); 1,3-beta-glucan synthase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
Swiss-ProtQ9LYS602191631918CALS6_ARATH RecName: Full=Putative callose synthase 6; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 11
RefSeqXP_002300874.101191211913predicted protein [Populus trichocarpa]
RefSeqXP_002307554.101191211928predicted protein [Populus trichocarpa]
RefSeqXP_002526651.101191211902transferase, transferring glycosyl groups, putative [Ricinus communis]
Transmembrane Domains
StartEnd
498520
535557
570592
612634
678700
724743
748770
14811503
16251642
16521674
17291748
17581775
17951817
18221841
18621884
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO425519626129019110
HO780746512107015710
HO780496339134516830
HO780496132122613440
HO780496204167218740
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_056_00094.1Aquca_014_00906.1Aquca_019_00181.4Aquca_019_00181.3Aquca_019_00181.1
Aquca_016_00166.1Aquca_019_00181.2Aquca_084_00016.4Aquca_084_00016.3Aquca_084_00016.2
Aquca_084_00016.1Aquca_022_00132.2Aquca_022_00132.1Aquca_014_00908.4Aquca_014_00908.3
Aquca_014_00908.2Aquca_014_00908.1Aquca_014_00908.5Aquca_008_00266.1Aquca_039_00091.4
Aquca_039_00091.2Aquca_039_00091.1Aquca_039_00091.3Aquca_056_00094.2
Arabidopsis lyrata340908482666470669899601907409
878725482124490214490142897726
325786
Arabidopsis thalianaAT3G07160.1AT2G36850.1AT1G06490.1AT4G03550.1AT2G13680.1
AT1G05570.2AT1G05570.1AT4G04970.1AT3G59100.1AT2G31960.2
AT2G31960.1AT5G13000.1AT5G13000.2AT3G14570.2AT3G14570.1
AT5G36870.1
Brachypodium distachyonBradi1g51757.1Bradi1g77247.2Bradi1g77247.1Bradi1g47427.1Bradi2g50140.1
Bradi3g60790.2Bradi3g60790.1Bradi1g29622.1Bradi1g76617.1Bradi2g46250.1
Bradi2g40460.1Bradi3g09317.1Bradi2g40430.1
Brassica rapaBra005239Bra029628Bra001239Bra040364Bra015504
Bra034218Bra032416Bra037213Bra029541Bra015436
Bra003364Bra023386Bra008864Bra005624Bra027328
Carica papayaevm.model.supercontig_42.151evm.model.supercontig_189.7evm.model.supercontig_25.167evm.model.supercontig_858.3evm.model.supercontig_2050.2
evm.model.supercontig_3407.1evm.model.supercontig_50.100evm.model.supercontig_4.57
Capsella rubellaCarubv10022498mCarubv10022499m
Citrus clementinaCiclev10014066mCiclev10018457mCiclev10018456mCiclev10000018mCiclev10018223m
Ciclev10030477mCiclev10030476mCiclev10014015mCiclev10030481mCiclev10030478m
Ciclev10030495mCiclev10024186mCiclev10030599mCiclev10030560mCiclev10030796m
Citrus sinensisorange1.1g000946morange1.1g000813morange1.1g000382morange1.1g000253morange1.1g000219m
orange1.1g000179morange1.1g000260morange1.1g000273morange1.1g000180morange1.1g000261m
orange1.1g045737morange1.1g000259morange1.1g000258morange1.1g001004morange1.1g000585m
orange1.1g000171morange1.1g000349morange1.1g000165morange1.1g001473morange1.1g000389m
orange1.1g000385morange1.1g040336morange1.1g000763m
Cucumis sativusCucsa.157510.4Cucsa.157510.3Cucsa.157510.2Cucsa.157510.1Cucsa.142920.1
Cucsa.249900.1Cucsa.119100.1Cucsa.126670.1Cucsa.239610.1Cucsa.049980.10
Cucsa.142930.1Cucsa.049980.1Cucsa.058220.1Cucsa.058230.1
Eucalyptus grandisEucgr.B00160.1Eucgr.B03640.2Eucgr.B03640.1Eucgr.I00208.1Eucgr.K01028.4
Eucgr.K01028.3Eucgr.K01028.2Eucgr.K01028.1Eucgr.D00621.1Eucgr.A01821.1
Eucgr.K01027.1Eucgr.D00622.1Eucgr.J00836.1Eucgr.J00827.1Eucgr.F01403.1
Eucgr.A01827.1Eucgr.A02008.1Eucgr.A01817.1Eucgr.A01994.2Eucgr.A01994.1
Eucgr.A02010.1Eucgr.J00836.2Eucgr.A01997.1
Fragaria vescamrna09912.1-v1.0-hybridmrna17912.1-v1.0-hybridmrna17710.1-v1.0-hybridmrna28731.1-v1.0-hybridmrna02397.1-v1.0-hybrid
mrna24411.1-v1.0-hybridmrna26782.1-v1.0-hybridmrna28728.1-v1.0-hybrid.526.840mrna28728.1-v1.0-hybrid.526.840
Glycine maxGlyma06g18216.1Glyma04g36725.1Glyma20g38860.1Glyma10g44150.1Glyma05g32500.4
Glyma05g32500.3Glyma05g32500.2Glyma08g16660.1Glyma04g39120.2Glyma04g39120.1
Glyma13g37290.2Glyma08g42150.3Glyma08g42150.2Glyma08g42150.1Glyma18g12870.3
Glyma18g12870.2Glyma18g12870.1Glyma15g08020.3Glyma15g08020.2Glyma15g08020.1
Glyma15g42330.4Glyma15g42330.3Glyma15g42330.2Glyma18g53823.1Glyma08g47670.1
Glyma08g47670.2Glyma18g13105.9Glyma18g13105.8Glyma18g13105.7Glyma18g13105.6
Glyma18g13105.10Glyma18g13105.3Glyma18g13105.2Glyma18g13105.1Glyma18g13105.5
Glyma18g13105.4Glyma15g39420.2Glyma13g33560.1Glyma05g32500.6Glyma05g32500.5
Glyma08g42110.1Glyma06g44770.3Glyma06g44770.2Glyma13g31310.1Glyma06g44770.4
Glyma10g44150.2Glyma08g16715.1Glyma06g15860.1.320.682Glyma06g15860.1.320.682Glyma08g16730.2
Gossypium raimondiiGorai.004G018200.3Gorai.004G018200.1Gorai.004G018200.2Gorai.003G109000.6Gorai.003G109000.1
Gorai.003G109000.2Gorai.003G109000.3Gorai.003G109000.4Gorai.011G120300.1Gorai.005G201500.2
Gorai.005G201500.1Gorai.011G119900.1Gorai.013G075600.1Gorai.004G092500.3Gorai.004G092500.2
Gorai.004G092500.1Gorai.011G096900.3Gorai.011G096900.1Gorai.004G092600.3Gorai.004G092600.1
Gorai.009G169700.3Gorai.009G169700.2Gorai.009G169700.1Gorai.012G187400.3Gorai.012G187400.2
Gorai.012G187400.1Gorai.004G092600.2Gorai.004G092600.4Gorai.012G040000.2Gorai.012G040000.1
Gorai.005G042700.1Gorai.005G043100.1Gorai.012G128700.1Gorai.007G334800.1Gorai.007G334800.2
Gorai.003G109000.5
Linum usitatissimumLus10014796Lus10032463Lus10039828Lus10000266Lus10031648
Lus10033689Lus10001424Lus10001056Lus10003920Lus10039199
Lus10037469Lus10013744Lus10033483Lus10007327Lus10030030
Lus10042478Lus10020893Lus10020750Lus10040891.301.669Lus10040891.301.669
Lus10002096Lus10002097
Malus domesticaMDP0000174437MDP0000286691MDP0000245319MDP0000275961MDP0000915307
MDP0000229527MDP0000230907MDP0000203763MDP0000321472MDP0000220467
MDP0000308574MDP0000198973MDP0000230621MDP0000212172.415.839MDP0000212172.415.839
MDP0000372473MDP0000310065MDP0000213931MDP0000218486.624.863MDP0000218486.624.863
MDP0000218486.624.863
Manihot esculentacassava4.1_001919mcassava4.1_031653mcassava4.1_029201mcassava4.1_000111mcassava4.1_000342m
cassava4.1_000112mcassava4.1_000082mcassava4.1_026004mcassava4.1_002527mcassava4.1_003374m
cassava4.1_003342mcassava4.1_006866mcassava4.1_028751mcassava4.1_033421m
Medicago truncatulaMedtr4g078220.1Medtr3g047390.1Medtr7g005950.1Medtr1g116370.1AC235753_1023.1
Medtr1g116470.1.521.981Medtr1g116470.1.521.981Medtr1g116470.1.228.504Medtr1g116470.1.228.504
Mimulus guttatusmgv1a000080mmgv1a000075mmgv1a000084mmgv1a000082mmgv1a000070m
mgv1a000067mmgv1a000108mmgv1a024191mmgv1a000066mmgv1a000106m
mgv1a000068m
Oryza sativaLOC_Os06g08380.1LOC_Os02g58560.1LOC_Os01g55040.1LOC_Os06g51270.1LOC_Os03g03610.3
LOC_Os03g03610.2LOC_Os03g03610.1LOC_Os02g58560.3LOC_Os02g14900.1LOC_Os01g34930.1
LOC_Os01g48200.1LOC_Os01g34890.1LOC_Os01g34880.1
Panicum virgatumPavirv00009928mPavirv00009617mPavirv00009495mPavirv00057448mPavirv00022973m
Pavirv00045342mPavirv00015084mPavirv00020404mPavirv00041942mPavirv00010502m
Pavirv00026821mPavirv00007196mPavirv00061397mPavirv00045035mPavirv00040188m
Pavirv00056028mPavirv00049749mPavirv00048524mPavirv00058599m
Physcomitrella patensPp1s88_136V6.1Pp1s160_88V6.1Pp1s40_186V6.2Pp1s67_234V6.1Pp1s67_70V6.1
Pp1s145_49V6.1Pp1s18_300V6.2Pp1s199_13V6.1Pp1s13_132V6.1Pp1s13_432V6.1
Pp1s379_24V6.1Pp1s66_72V6.1
Phaseolus vulgarisPhvul.007G004900.2Phvul.007G004900.1Phvul.007G004900.3Phvul.002G272000.1Phvul.009G150300.2
Phvul.009G150300.1Phvul.011G113800.1Phvul.006G185600.2Phvul.006G185600.1Phvul.006G031900.1
Phvul.005G103600.1Phvul.008G002300.1Phvul.005G040900.2Phvul.007G005100.1Phvul.005G040900.1
Phvul.005G062500.1Phvul.009G169400.1
Picea abiesMA_10428413g0040MA_826577g0010MA_960362g0010MA_10426974g0030MA_735748g0010
MA_6205g0020MA_10426974g0020MA_10430560g0010MA_10431062g0010MA_229544g0010
MA_10434444g0010MA_10431631g0010
Populus trichocarpaPotri.015G089300.1Potri.001G011900.1Potri.005G058300.2Potri.005G058300.1Potri.013G131300.1
Potri.001G230000.9Potri.001G230000.8Potri.001G230000.7Potri.001G230000.6Potri.001G230000.5
Potri.001G230000.4Potri.001G230000.3Potri.001G230000.2Potri.001G230000.17Potri.001G230000.16
Potri.011G052400.6Potri.011G052400.5Potri.011G052400.4Potri.011G052400.3Potri.011G052400.2
Potri.011G052400.1Potri.002G058700.3Potri.002G058700.2Potri.002G058700.1Potri.001G012200.3
Potri.001G012200.1Potri.001G012200.2Potri.005G203500.2Potri.005G203500.1Potri.003G214200.2
Potri.003G214200.1Potri.011G095100.2Potri.011G095100.1Potri.001G230000.10Potri.001G230000.18
Potri.001G012200.5Potri.001G012200.4Potri.005G203500.3Potri.001G230000.11Potri.001G230000.12
Potri.001G230000.13
Prunus persicappa000071mppa000167mppa000077mppa000074mppa001863m
ppa000121mppa000112mppa002267mppa000073mppa003008m
ppa000306m
Ricinus communis30147.m01381228035.m00035829691.m00028229983.m00319129734.m000419
28035.m00035929759.m00028130226.m00202329983.m00319229851.m002416
Setaria italicaSi033860mSi034369mSi034352mSi008368mSi016068m
Si016067mSi000021mSi000023mSi000022mSi000017m
Si033956mSi033893mSi033872mSi016150mSi000059m
Selaginella moellendorffii133452439692163802267830177798
449402
Sorghum bicolorSb10g005550.1Sb04g038510.1Sb10g030970.1Sb01g048630.1Sb03g023490.1
Sb03g030800.1Sb03g034880.1Sb04g008830.1
Thellungiella halophilaThhalv10019878mThhalv10016126mThhalv10006529mThhalv10022518mThhalv10028360m
Thhalv10028359mThhalv10006533mThhalv10006528mThhalv10016125mThhalv10012412m
Thhalv10005734mThhalv10019876mThhalv10029222m
Vitis viniferaGSVIVT01025370001GSVIVT01007560001GSVIVT01026489001GSVIVT01001361001GSVIVT01020854001
GSVIVT01025362001GSVIVT01000622001GSVIVT01005204001GSVIVT01020548001.494.863GSVIVT01020548001.494.863
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)