y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.006G047000.1
FamilyGH13
Protein PropertiesLength: 900 Molecular Weight: 103946 Isoelectric Point: 6.6821
ChromosomeChromosome/Scaffold: 06 Start: 16048871 End: 16060227
DescriptionAlpha amylase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH134087412.2e-24
  GSDPKISSFNDFTDEVLPYIKDAGYNAIQLIGIVEHKDYFTVGYRVTNYFAVSSRYGIPEDFKRLVDEAHGLGLLVFLEIVHSYAAADEMVGLSMFDGSN
  DCFFRSGKRGQHKFWGTRMFKYGDPDVLHFLVSNLNWWIVEYQIDGFQFHSVSSMLYTHNGFASFTGDLEEYCNQYVDKDALVYLILANEILHSLHPNIV
  TIAEDATFYPGLCEPTSQGGLGFDYYVNLSVPDMWSTLLDSVPDYEWNMTKIVNTLVSKREYADKMLTYAENHNQSISGRRSFAEILFGEIDENSHHYKE
  SLLRGSSLHKMIRLITLTIGGRAYLNFMGNEFGH
Full Sequence
Protein Sequence     Length: 900     Download
MSTLSIPFKF YFPPTTATSF PPSQTKPQNL TFQRRTRTTT KTACAASENP KKRQKPKKKQ    60
TETKTETTSD DGEKGIDPAG FLEKRGISHK AFALFLRERY KILKDIKDEI LKRHANFMIL    120
ASGFELLGMH RHPEHRVDYM EWAPGARYCA IVGDFNDWSP TENCAREHYF GHDDYGYWFI    180
ILQDKLREGE EPDKYYFQMY NYADDYDKGD SGITLEEILK KANDEYWEPG EDRYLNNRYE    240
GPVKLYEQIF GPNGPQTIED IPDVPDPKTR YKAWAAEHGP SRTAAMDSGK EYDIYNVIVD    300
PEWHEKMRSL KPPIAYWFET RKGRKAWMKK YSPSIPHGSK YRVYFNTPNG PLERVPAWAT    360
YVQPEVDGRQ AYAIHWEPPP EQAYKWKNAS PKVPTSLRIY EAHVGISGSD PKISSFNDFT    420
DEVLPYIKDA GYNAIQLIGI VEHKDYFTVG YRVTNYFAVS SRYGIPEDFK RLVDEAHGLG    480
LLVFLEIVHS YAAADEMVGL SMFDGSNDCF FRSGKRGQHK FWGTRMFKYG DPDVLHFLVS    540
NLNWWIVEYQ IDGFQFHSVS SMLYTHNGFA SFTGDLEEYC NQYVDKDALV YLILANEILH    600
SLHPNIVTIA EDATFYPGLC EPTSQGGLGF DYYVNLSVPD MWSTLLDSVP DYEWNMTKIV    660
NTLVSKREYA DKMLTYAENH NQSISGRRSF AEILFGEIDE NSHHYKESLL RGSSLHKMIR    720
LITLTIGGRA YLNFMGNEFG HPKRVEFPSS SNNNSYLLAN RCWDLLAKDG VHRDLFSFDK    780
DMMKLDENQR VLSRVFPNIH HVNDSSMVIS YIRGPLVFIF NFHPKESYDS YSIGVEEAGE    840
YQIIMNTDEI KYGGQGKLKE NQYFLKTISK RVDGLRNCLE VSLPSRTAQV YKLKRILRI*    900
                                                                     960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02447PLN024477.0e-912118464+
cd11321AmyAc_bac_euk_BE2.0e-172380780411+
PLN02960PLN02960070899836+
PLN03244PLN03244071899837+
PLN02447PLN024470332891569+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAB02827.1018991903starch-branching enzyme-like protein [Arabidopsis thaliana]
EMBLCBI26672.1018991896unnamed protein product [Vitis vinifera]
RefSeqNP_001154629.1018991899alpha-amylase/ catalytic/ cation binding [Arabidopsis thaliana]
RefSeqXP_002278858.1018991866PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002529457.10289038921,4-alpha-glucan branching enzyme, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3amk_A0333858114650A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3aml_A0333858114650A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3vu2_B0333858114650A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BF2725172783546310
CO1045252733816530
JG6363292703416100
DY9658212932695550
EH7187682633596210
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_066_00053.1Aquca_027_00415.5Aquca_027_00415.4Aquca_027_00415.3Aquca_027_00415.2
Aquca_027_00415.1Aquca_015_00400.6Aquca_015_00400.5Aquca_015_00400.2Aquca_015_00400.1
Aquca_015_00400.3Aquca_015_00400.4
Arabidopsis lyrata873536321348908239
Arabidopsis thalianaAT3G20440.3AT3G20440.2AT2G36390.1AT5G03650.1
Brachypodium distachyonBradi1g41970.2Bradi1g41970.1Bradi1g29850.2Bradi1g29850.1Bradi5g09170.2
Bradi5g09170.1Bradi3g44760.1
Brassica rapaBra035782Bra005269Bra017241Bra009521
Carica papayaevm.model.supercontig_5.62
Capsella rubellaCarubv10012936mCarubv10022617mCarubv10000235m
Chlamydomonas reinhardtiiCre06.g270100.t1.3Cre10.g444700.t1.1Cre06.g289850.t1.3Cre08.g373450.t1.1
Citrus clementinaCiclev10007401mCiclev10011063mCiclev10000406mCiclev10000374mCiclev10000272m
Ciclev10000256m
Citrus sinensisorange1.1g035501morange1.1g002609morange1.1g004765morange1.1g004253morange1.1g003474m
orange1.1g003390morange1.1g003230morange1.1g003226m
Cucumis sativusCucsa.378410.2Cucsa.378410.1Cucsa.077550.3Cucsa.077550.1Cucsa.077550.2
Eucalyptus grandisEucgr.F03487.1Eucgr.A01533.1Eucgr.F01770.1
Fragaria vescamrna30233.1-v1.0-hybridmrna08644.1-v1.0-hybridmrna08646.1-v1.0-hybrid
Glycine maxGlyma18g10385.1Glyma03g35020.2Glyma03g35020.1Glyma19g37750.2Glyma19g37750.1
Glyma04g01950.2
Gossypium raimondiiGorai.009G406400.4Gorai.011G196000.5Gorai.011G196000.4Gorai.011G196000.3Gorai.011G196000.2
Gorai.011G196000.12Gorai.011G196000.1Gorai.011G196000.7Gorai.011G196000.6Gorai.011G196000.13
Gorai.002G172100.7Gorai.002G172100.5Gorai.002G172100.3Gorai.002G172100.2Gorai.002G172100.1
Gorai.009G441800.2Gorai.009G441800.1Gorai.009G406400.6Gorai.009G406400.5Gorai.009G406400.3
Gorai.009G406400.2Gorai.009G406400.1Gorai.002G241400.7Gorai.002G241400.6Gorai.002G241400.5
Gorai.002G241400.4Gorai.002G241400.2Gorai.002G241400.1Gorai.005G113800.3Gorai.005G113800.2
Gorai.005G113800.1
Linum usitatissimumLus10000912Lus10023878Lus10014382Lus10016012Lus10012264
Malus domesticaMDP0000218396MDP0000148418MDP0000214735MDP0000177786
Manihot esculentacassava4.1_006199mcassava4.1_004366mcassava4.1_003773mcassava4.1_001701mcassava4.1_001686m
cassava4.1_002337mcassava4.1_002172mcassava4.1_002171mcassava4.1_001826mcassava4.1_001598m
cassava4.1_001595m
Medicago truncatulaMedtr7g104080.1
Mimulus guttatusmgv1a001162mmgv1a001301mmgv1a001932m
Oryza sativaLOC_Os02g32660.2LOC_Os06g26234.3LOC_Os06g26234.2LOC_Os06g26234.1LOC_Os02g32660.1
LOC_Os06g51084.8LOC_Os06g51084.7LOC_Os06g51084.6LOC_Os06g51084.5LOC_Os06g51084.4
LOC_Os06g51084.3LOC_Os06g51084.2LOC_Os06g51084.1
Panicum virgatumPavirv00035568mPavirv00058932mPavirv00002278mPavirv00067040mPavirv00061484m
Pavirv00061483mPavirv00061485m
Physcomitrella patensPp1s200_23V6.1Pp1s15_181V6.2Pp1s15_181V6.1Pp1s54_189V6.2Pp1s54_189V6.1
Pp1s64_78V6.1
Phaseolus vulgarisPhvul.001G187600.1Phvul.009G011000.1
Picea abiesMA_10430611g0010
Populus trichocarpaPotri.006G115100.5Potri.001G359200.1Potri.006G115100.6Potri.006G115100.4Potri.006G115100.3
Potri.006G115100.2Potri.006G115100.1Potri.005G251000.5Potri.005G251000.4Potri.005G251000.3
Potri.005G251000.2Potri.005G251000.1Potri.005G251000.6
Prunus persicappa016544mppa001312mppa001929m
Ricinus communis29762.m00048630170.m01435927496.m000095
Setaria italicaSi008087mSi016350mSi009379mSi009312mSi005911m
Si006006mSi006081m
Selaginella moellendorffii165481437348437417
Sorghum bicolorSb03g027310.1Sb04g021540.1Sb06g015360.1Sb10g030776.1
Thellungiella halophilaThhalv10020019mThhalv10016249mThhalv10012785mThhalv10012784mThhalv10012679m
Vitis viniferaGSVIVT01037695001GSVIVT01033801001GSVIVT01008673001
Volvox carteriVocar20012173mVocar20015251mVocar20002436mVocar20007338m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)