y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.006G064100.1
FamilyGT35
Protein PropertiesLength: 847 Molecular Weight: 95977.1 Isoelectric Point: 6.2959
ChromosomeChromosome/Scaffold: 06 Start: 18176797 End: 18184880
Descriptionalpha-glucan phosphorylase 2
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT351218410
  ALRKFGLELEEITEQEKDAALGNGGLGRLASCFLDSMATLNLPAWGYGLRYRYGLFKQKITREGQEEVAEDWLEKFSPWEVVRHDILYPIRFFGHVEVNP
  NGSRKWVGGEVVRALAYDVPIPGYQTKNTISLRLWEAKASAEDFNLFSFNDGQHDAASVLHSRAQQICAVLYPGDTTEGGKLLRLKQQFFLCSASLQDII
  SRFKERRQGPWNWSEFPTKVAVQLNDTHPTLVIPELMRLLLDDEELGWEEAWDVTSRTVAYTNHTVLPEALEKWSQPVMWKLLPRHMEIIQEIDKRFTAM
  INTTRLDLESELSTMCILDDNPQKPVVRMANLCVVSSHAVNGVAQLHSDILKSELFANYVSIWPTKFQNKTNGITPRRWIQFCNPELSGIITKWLKTDKW
  VTNLDLLTGLRQFADNEDLQEEWLSAKMASKQRLARYVLQVTGESIDPDSLFDIQVKRIHEYKRQLLNILGVIYRFKKLKEMSPEERKKSTPRTVMIGGK
  AFATYTNAIRTVRLVNDVGAVVNSDPEVNSFLKVVFVPNYNVSVAEVLIPGSELSQHISTAGMEASGTSNMKFALNGCLIIGTLDGANVEIREEIGEENF
  FLFGATAEEVPRLRKERENGLFKPDPRFEEAKKFIRSGVFGSYDYSPLLESLEGNSGYGRGDYFLVGHDFPSYMDAQAKVDEAYRDRKKWLKMSILSTAG
  SGKFSSDRTIAQYAKEIWNIE
Full Sequence
Protein Sequence     Length: 847     Download
MAAKVEANGG SDKVGVSAVS AKIPAVAHPL AEKPDEVASN ISYHAQFSPH FSPFKFELEQ    60
AYYATAESVR DRLIRQWNET YAHFHKVDPK QTYYLSMEFL QGRALTNAIG NLNIQDAYAN    120
ALRKFGLELE EITEQEKDAA LGNGGLGRLA SCFLDSMATL NLPAWGYGLR YRYGLFKQKI    180
TREGQEEVAE DWLEKFSPWE VVRHDILYPI RFFGHVEVNP NGSRKWVGGE VVRALAYDVP    240
IPGYQTKNTI SLRLWEAKAS AEDFNLFSFN DGQHDAASVL HSRAQQICAV LYPGDTTEGG    300
KLLRLKQQFF LCSASLQDII SRFKERRQGP WNWSEFPTKV AVQLNDTHPT LVIPELMRLL    360
LDDEELGWEE AWDVTSRTVA YTNHTVLPEA LEKWSQPVMW KLLPRHMEII QEIDKRFTAM    420
INTTRLDLES ELSTMCILDD NPQKPVVRMA NLCVVSSHAV NGVAQLHSDI LKSELFANYV    480
SIWPTKFQNK TNGITPRRWI QFCNPELSGI ITKWLKTDKW VTNLDLLTGL RQFADNEDLQ    540
EEWLSAKMAS KQRLARYVLQ VTGESIDPDS LFDIQVKRIH EYKRQLLNIL GVIYRFKKLK    600
EMSPEERKKS TPRTVMIGGK AFATYTNAIR TVRLVNDVGA VVNSDPEVNS FLKVVFVPNY    660
NVSVAEVLIP GSELSQHIST AGMEASGTSN MKFALNGCLI IGTLDGANVE IREEIGEENF    720
FLFGATAEEV PRLRKERENG LFKPDPRFEE AKKFIRSGVF GSYDYSPLLE SLEGNSGYGR    780
GDYFLVGHDF PSYMDAQAKV DEAYRDRKKW LKMSILSTAG SGKFSSDRTI AQYAKEIWNI    840
EECRVP*                                                              900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd04300GT1_Glycogen_Phosphorylase038840811+
TIGR02093P_ylase041840808+
pfam00343Phosphorylase0121842727+
PRK14986PRK14986064845787+
COG0058GlgP033841813+
Gene Ontology
GO TermDescription
GO:0004645phosphorylase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAG31926.1038462843alpha-1,4-glucan phosphorylase H isozyme [Cucurbita maxima]
Swiss-ProtP53537018461842PHSH_VICFA RecName: Full=Alpha-glucan phosphorylase, H isozyme; AltName: Full=Starch phosphorylase H
RefSeqXP_002280732.1018461843PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002313399.10784611853predicted protein [Populus trichocarpa]
RefSeqXP_002520435.1058466849glycogen phosphorylase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1z8d_A06284453832A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose
PDB1ygp_B06184168876A Chain A, Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site.
PDB1ygp_A06184168876A Chain A, Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site.
PDB2gj4_A06284441820A Chain A, Structure Of Rabbit Muscle Glycogen Phosphorylase In Complex With Ligand
PDB4el5_A06284441820A Chain A, Structure Of Rabbit Muscle Glycogen Phosphorylase In Complex With Ligand
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7822004101775860
HO80157034413440
HO4180365392477620
HO7800103115378470
HO780010374935290.000000000000003
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00755.3Aquca_009_00755.2Aquca_009_00755.1Aquca_002_00786.1Aquca_002_00786.2
Arabidopsis lyrata485074323006
Arabidopsis thalianaAT3G46970.1AT3G29320.1
Brachypodium distachyonBradi2g55120.1Bradi1g08070.1.569.972Bradi1g08070.1.569.972Bradi1g08070.1.163.525Bradi1g08070.1.163.525
Brassica rapaBra018180Bra025392Bra033098
Carica papayaevm.model.supercontig_27.5evm.model.supercontig_112.64.358.739evm.model.supercontig_112.64.358.739evm.model.supercontig_14.158evm.model.supercontig_112.64.117.357
evm.model.supercontig_112.64.117.357
Capsella rubellaCarubv10019408mCarubv10016634m
Chlamydomonas reinhardtiiCre12.g552200.t1.2Cre07.g336950.t1.1
Citrus clementinaCiclev10027815mCiclev10027813mCiclev10010975m.585.995Ciclev10010975m.585.995Ciclev10010975m.176.514
Ciclev10010975m.176.514
Citrus sinensisorange1.1g004485morange1.1g003202morange1.1g003197morange1.1g003196morange1.1g003188m
orange1.1g003186morange1.1g005595morange1.1g003693morange1.1g003742morange1.1g004697m
orange1.1g004696morange1.1g007597morange1.1g003875m.374.784orange1.1g003875m.374.784orange1.1g003079m.434.844
orange1.1g003079m.434.844orange1.1g003074m.434.844orange1.1g003074m.434.844orange1.1g003072m.434.844orange1.1g003072m.434.844
orange1.1g003055m.436.846orange1.1g003055m.436.846orange1.1g001879m.585.995orange1.1g001879m.585.995orange1.1g009651m
orange1.1g002111morange1.1g012447morange1.1g005402m.400.692orange1.1g005402m.400.692orange1.1g005402m.25.349
orange1.1g005402m.25.349orange1.1g003079m.25.349orange1.1g003079m.25.349orange1.1g003074m.25.349orange1.1g003074m.25.349
orange1.1g003072m.25.349orange1.1g003072m.25.349orange1.1g001879m.176.500orange1.1g001879m.176.500orange1.1g003055m.25.351
orange1.1g003055m.25.351orange1.1g026345m
Cucumis sativusCucsa.126920.10Cucsa.126920.1Cucsa.139040.4Cucsa.139040.3Cucsa.139040.2
Cucsa.139040.1Cucsa.284600.1Cucsa.273090.1
Eucalyptus grandisEucgr.B02278.2Eucgr.B02278.1Eucgr.B03166.3Eucgr.B03166.2Eucgr.J01374.1
Eucgr.B03166.1Eucgr.B03166.5Eucgr.B03166.4
Fragaria vescamrna29749.1-v1.0-hybridmrna07968.1-v1.0-hybridmrna04322.1-v1.0-hybrid.157.481mrna04322.1-v1.0-hybrid.157.481
Glycine maxGlyma13g30920.2Glyma13g30920.3Glyma08g45210.1Glyma18g07480.1Glyma20g03250.4.554.965
Glyma20g03250.4.554.965Glyma20g03250.3.562.973Glyma20g03250.3.562.973Glyma20g03250.2.562.973Glyma20g03250.2.562.973
Glyma13g06040.1Glyma19g03490.1Glyma20g03250.4.161.485Glyma20g03250.4.161.485Glyma20g03250.3.169.493
Glyma20g03250.3.169.493Glyma20g03250.2.169.493Glyma20g03250.2.169.493
Gossypium raimondiiGorai.009G166800.1Gorai.013G260900.2Gorai.013G260900.1Gorai.013G260900.3Gorai.006G011500.7.330.728
Gorai.006G011500.7.330.728Gorai.006G011500.4.514.912Gorai.006G011500.4.514.912Gorai.006G011500.3.580.978Gorai.006G011500.3.580.978
Gorai.006G011500.2.583.981Gorai.006G011500.2.583.981Gorai.006G011500.1.583.986Gorai.006G011500.1.583.986Gorai.013G092200.1
Gorai.013G092200.2Gorai.006G011500.6.177.501Gorai.006G011500.6.177.501Gorai.006G011500.5.180.504Gorai.006G011500.5.180.504
Gorai.006G011500.4.111.435Gorai.006G011500.4.111.435Gorai.006G011500.3.177.501Gorai.006G011500.3.177.501Gorai.006G011500.2.180.504
Gorai.006G011500.2.180.504Gorai.006G011500.1.180.504Gorai.006G011500.1.180.504Gorai.006G011500.6.580.815Gorai.006G011500.6.580.815
Gorai.006G011500.5.583.818Gorai.006G011500.5.583.818
Linum usitatissimumLus10036892Lus10042688Lus10037093Lus10029643Lus10029644
Malus domesticaMDP0000288190MDP0000123354MDP0000266061MDP0000129346.602.999MDP0000129346.602.999
MDP0000145828MDP0000128518MDP0000778598MDP0000259799MDP0000129346.170.509
MDP0000129346.170.509MDP0000211642
Manihot esculentacassava4.1_001626mcassava4.1_002082mcassava4.1_024481mcassava4.1_002466mcassava4.1_002614m.310.707
cassava4.1_002614m.310.707cassava4.1_001096mcassava4.1_025456mcassava4.1_007176mcassava4.1_004717m.211.560
cassava4.1_004717m.211.560cassava4.1_002614m.25.217cassava4.1_002614m.25.217cassava4.1_004717m.25.195cassava4.1_004717m.25.195
cassava4.1_009211m
Medicago truncatulaMedtr2g014460.1Medtr6g014480.1Medtr4g082950.1.578.876Medtr4g082950.1.578.876Medtr4g082950.1.170.494
Medtr4g082950.1.170.494Medtr6g014480.2
Mimulus guttatusmgv1a000698mmgv1a001277mmgv1a000878mmgv1a002586mmgv1a002585m
Oryza sativaLOC_Os01g63270.1LOC_Os01g63270.2LOC_Os03g55090.1
Panicum virgatumPavirv00009874mPavirv00050649mPavirv00050650mPavirv00004990m.515.914Pavirv00004990m.515.914
Pavirv00034922m.529.918Pavirv00034922m.529.918Pavirv00034922m.119.465Pavirv00034922m.119.465Pavirv00004990m.97.438
Pavirv00004990m.97.438
Physcomitrella patensPp1s30_182V6.1Pp1s180_124V6.1Pp1s86_213V6.1Pp1s195_41V6.1Pp1s53_212V6.1.566.981
Pp1s53_212V6.1.566.981Pp1s53_212V6.1.179.499Pp1s53_212V6.1.179.499
Phaseolus vulgarisPhvul.006G182300.1Phvul.002G168400.1.570.971Phvul.002G168400.1.570.971Phvul.004G034400.1.582.980Phvul.004G034400.1.582.980
Phvul.002G168400.1.169.519Phvul.002G168400.1.169.519Phvul.004G034400.1.180.504Phvul.004G034400.1.180.504
Picea abiesMA_10437129g0010MA_14581g0010MA_10428980g0010
Populus trichocarpaPotri.004G048600.1Potri.004G048600.2Potri.009G041800.1Potri.009G041800.3Potri.010G160200.2
Potri.009G041800.4Potri.009G041800.2.126.655Potri.009G041800.2.126.655Potri.004G123600.5Potri.010G160200.5
Potri.010G160200.1Potri.010G160200.7Potri.010G160200.4Potri.010G160200.3Potri.004G123600.4.176.534
Potri.004G123600.4.176.534Potri.004G123600.3.176.534Potri.004G123600.3.176.534Potri.004G123600.2.176.534Potri.004G123600.2.176.534
Potri.004G123600.1.176.533Potri.004G123600.1.176.533Potri.010G160200.6Potri.009G041800.2.660.825Potri.009G041800.2.660.825
Prunus persicappa000587mppa001354mppa000958mppa000827m.586.983ppa000827m.586.983
ppa000827m.171.506ppa000827m.171.506
Ricinus communis29751.m00179630190.m011310.461.94330190.m011310.461.94330174.m00913629630.m000793
30190.m011310.264.44430190.m011310.264.444
Setaria italicaSi000306mSi034019m
Selaginella moellendorffii148158164611184206
Sorghum bicolorSb03g040060.1Sb01g007560.2.550.949Sb01g007560.2.550.949Sb01g007560.1.580.979Sb01g007560.1.580.979
Sb01g007560.2.140.492Sb01g007560.2.140.492Sb01g007560.1.170.522Sb01g007560.1.170.522
Thellungiella halophilaThhalv10010122mThhalv10003599m
Vitis viniferaGSVIVT01021111001GSVIVT01024804001GSVIVT01012194001GSVIVT01011504001.577.977GSVIVT01011504001.577.977
GSVIVT01011504001.177.501GSVIVT01011504001.177.501
Volvox carteriVocar20006426mVocar20001423m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)