y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.006G092100.1
FamilyGH2
Protein PropertiesLength: 972 Molecular Weight: 109936 Isoelectric Point: 5.9525
ChromosomeChromosome/Scaffold: 06 Start: 21076304 End: 21082654
Descriptionglycoside hydrolase family 2 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH257580
  HRKTTLDSGWVAARSTEVKFTGTQLTTTHPPTGPTSPWMEALVPATVLATLVKNKVVPDPFYGLQNEHIVDIADSGRDYYTFWFFTTFNCKLSSNEHCDL
  NFRGINYSADVYLNGHEIILPKGMFRRHSIDVTDIVHADGTNLLAVLVHPPDHPGRIPPTGGQGGDHEIGKDVATQYVEGWDWMAPIRDRNTGIWDEVSI
  SVTGPVKIIDPHLVSTFSDDYKKAYLHTTIELQNKSSRTAECSLSVQVTLEPEDSIFLVEHLQTQNLSVPANSRVQYTFPELIFSKPNLWWPNGMGKQSL
  YNVVISIDVKGFGESDSWSHHFGFRKIESHIDNATGGRLFKVNGEPIFIRGGNWILSDGLLRFSKKRYSTDIKFHADMNFNMIRCWGGGLAERPEFYHYC
  DYYGLLVWQEFWITGDVDGRGDPVSNPDGPLDHDLFLFCARDTVKLLRNHPSLALWVGGNEQIPPADINAALKYDLRLHPHFESKDENSKPVGDVSPTLS
  DPSQYLDGTRIYIQGSMWDGFADGMGNFTDGPYEIQNPEDFFKDDYYKYGFNPEVGSVGMPVAATIRATMPSEGWQIPLFKKHPNGYVEEVPNAIWEYHK
  YIPYSKPTKVHDQIQLYGDAKDLDDFCLKAQLVNYIQYRALLEGWTSRMWSKYTGVLIWKTQNPWTGLRGQFYDHLLDQTAGFYGCRCAAEPIHVQLNLA
  TYLIEVVNTTSEELSNVAIETSVWDLEGKRPYYSLNENLSLLPKKVAPIVEMKY
Full Sequence
Protein Sequence     Length: 972     Download
MAEQHRKTTL DSGWVAARST EVKFTGTQLT TTHPPTGPTS PWMEALVPAT VLATLVKNKV    60
VPDPFYGLQN EHIVDIADSG RDYYTFWFFT TFNCKLSSNE HCDLNFRGIN YSADVYLNGH    120
EIILPKGMFR RHSIDVTDIV HADGTNLLAV LVHPPDHPGR IPPTGGQGGD HEIGKDVATQ    180
YVEGWDWMAP IRDRNTGIWD EVSISVTGPV KIIDPHLVST FSDDYKKAYL HTTIELQNKS    240
SRTAECSLSV QVTLEPEDSI FLVEHLQTQN LSVPANSRVQ YTFPELIFSK PNLWWPNGMG    300
KQSLYNVVIS IDVKGFGESD SWSHHFGFRK IESHIDNATG GRLFKVNGEP IFIRGGNWIL    360
SDGLLRFSKK RYSTDIKFHA DMNFNMIRCW GGGLAERPEF YHYCDYYGLL VWQEFWITGD    420
VDGRGDPVSN PDGPLDHDLF LFCARDTVKL LRNHPSLALW VGGNEQIPPA DINAALKYDL    480
RLHPHFESKD ENSKPVGDVS PTLSDPSQYL DGTRIYIQGS MWDGFADGMG NFTDGPYEIQ    540
NPEDFFKDDY YKYGFNPEVG SVGMPVAATI RATMPSEGWQ IPLFKKHPNG YVEEVPNAIW    600
EYHKYIPYSK PTKVHDQIQL YGDAKDLDDF CLKAQLVNYI QYRALLEGWT SRMWSKYTGV    660
LIWKTQNPWT GLRGQFYDHL LDQTAGFYGC RCAAEPIHVQ LNLATYLIEV VNTTSEELSN    720
VAIETSVWDL EGKRPYYSLN ENLSLLPKKV APIVEMKYPK SKDPKPVYFL LLKLYNMSDK    780
RVISRNFYWL HLSGGDYKLL EPYREKKIPL KITSKVSIQE SIYNIQMHVT NSSESPESRS    840
STVRPSDGFY GTQSLQTLDS GVGKEHQTDF KGIEGCFSGK SDGGLKVTEI NGSDVGVAFF    900
LQISVHTSKK DYKEGEDTRI LPVHYSDNYF SLVPGETMPI NISFESPQGV SPRVILHGWN    960
YKGGELIYEV V*                                                        1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK09525lacZ2.0e-8194465301+
PRK10150PRK101505.0e-1060508475+
pfam00703Glyco_hydro_21.0e-12210329120+
PRK10340ebgA4.0e-1699465382+
COG3250LacZ3.0e-4661688658+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN82620.1079686973hypothetical protein [Vitis vinifera]
EMBLCBI36793.1079686951unnamed protein product [Vitis vinifera]
RefSeqXP_002284576.1079686973PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002319539.1079686973predicted protein [Populus trichocarpa]
RefSeqXP_002512381.1079646969beta-mannosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vzo_B03579074767A Chain A, Crystal Structure Of Amycolatopsis Orientalis Exo- Chitosanase Csxa
PDB2vzo_A03579074767A Chain A, Crystal Structure Of Amycolatopsis Orientalis Exo- Chitosanase Csxa
PDB2vzu_B03579074767A Chain A, Complex Of Amycolatopsis Orientalis Exo-Chitosanase Csxa D469a With Pnp-Beta-D-Glucosamine
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES7939203373737090
GO8716003333016330
ES8327902995058030
GO8481592951664600
DY9156233065128170
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00437.1Aquca_017_00437.4Aquca_054_00086.1Aquca_017_00437.2Aquca_017_00437.5
Aquca_017_00437.3
Arabidopsis lyrata888134
Arabidopsis thalianaAT1G09010.1
Brachypodium distachyonBradi2g26600.1
Brassica rapaBra018587Bra030751
Carica papayaevm.model.supercontig_48.57
Capsella rubellaCarubv10008228m
Citrus clementinaCiclev10000150mCiclev10000160m
Citrus sinensisorange1.1g045314m
Cucumis sativusCucsa.182080.2Cucsa.182080.1
Eucalyptus grandisEucgr.H04490.2Eucgr.H04490.1Eucgr.H04490.3
Fragaria vescamrna22540.1-v1.0-hybrid
Glycine maxGlyma10g29550.1Glyma20g37760.1Glyma03g39810.1Glyma19g42370.1
Gossypium raimondiiGorai.013G124100.1Gorai.007G297200.2Gorai.007G297200.1Gorai.007G297200.3Gorai.007G297200.4
Linum usitatissimumLus10029917Lus10004484
Malus domesticaMDP0000300462MDP0000144916MDP0000026514MDP0000210658
Manihot esculentacassava4.1_001014m
Medicago truncatulaMedtr7g113570.1Medtr1g082890.1
Mimulus guttatusmgv1a023381mmgv1a000882mmgv1a024358m
Oryza sativaLOC_Os05g32530.1
Panicum virgatumPavirv00050693mPavirv00063196mPavirv00063197m
Physcomitrella patensPp1s2985_1V6.1Pp1s99_248V6.1Pp1s114_165V6.1
Phaseolus vulgarisPhvul.007G180100.1
Picea abiesMA_10427468g0010
Populus trichocarpaPotri.013G021200.4Potri.013G021200.3Potri.013G021200.1Potri.013G021200.2
Prunus persicappa000875mppa000882m
Ricinus communis30128.m008776
Setaria italicaSi021098m
Selaginella moellendorffii164536
Sorghum bicolorSb09g019350.1
Thellungiella halophilaThhalv10006730m
Vitis viniferaGSVIVT01000073001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny