y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.006G131600.1
FamilyGT65
Protein PropertiesLength: 442 Molecular Weight: 50724.6 Isoelectric Point: 8.8254
ChromosomeChromosome/Scaffold: 06 Start: 24671306 End: 24672631
DescriptionO-fucosyltransferase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT65763890
  GLNNQKIAFARASLTARMLNRTLLMPSLSASLFYKEVDLLQPISFDKVFQFDKFNTLCNGFVRLGRYSDVSNRTEVLEMEKGSGRRWTVERDLSQLKEHG
  KGYLDDHEVIRIVGKNPFLWHDHWPVKDYAMIFECLDLTEEIAKEADRVVSRIRAVRRKITGNTEAVEMQNSIINDASSFQPLPYVAVHMRIEIDWMIHC
  KNLERRLNTNQICSSKKEIVERVRNIAGLKTPVVVYLAVADKLLNNSSILEGWEEGFLPFEKKKLGVDGIYKKYPYLIQSAIDYEVCLRADTFVGNSFST
  FSSLIALERTQKMI
Full Sequence
Protein Sequence     Length: 442     Download
MEVLSKFSAS TMNSVTSKCM ILLVTVLIFR ALLFPSFPGF DRIEWSNFVY IRTPFLNFDF    60
GIRQDKFLVV PQIVWGLNNQ KIAFARASLT ARMLNRTLLM PSLSASLFYK EVDLLQPISF    120
DKVFQFDKFN TLCNGFVRLG RYSDVSNRTE VLEMEKGSGR RWTVERDLSQ LKEHGKGYLD    180
DHEVIRIVGK NPFLWHDHWP VKDYAMIFEC LDLTEEIAKE ADRVVSRIRA VRRKITGNTE    240
AVEMQNSIIN DASSFQPLPY VAVHMRIEID WMIHCKNLER RLNTNQICSS KKEIVERVRN    300
IAGLKTPVVV YLAVADKLLN NSSILEGWEE GFLPFEKKKL GVDGIYKKYP YLIQSAIDYE    360
VCLRADTFVG NSFSTFSSLI ALERTQKMIR MNATNLCGEN VRWPSYAYNV LGTSNGPMRW    420
VTNMSESNLQ AISYGTNHIS C*                                             480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd11296O-FucT_like0.00036710135+
cd11302O-FucT-18.0e-8259384145+
cd11299O-FucT_plant6.0e-1776385331+
cd11296O-FucT_like9.0e-25217385180+
pfam10250O-FucT8.0e-4276385341+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_187183.301444116442unknown protein [Arabidopsis thaliana]
RefSeqXP_002273827.10154411427PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002321799.10934411347predicted protein [Populus trichocarpa]
RefSeqXP_002332132.10934411347predicted protein [Populus trichocarpa]
RefSeqXP_002531235.101244117446conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3zy6_A0.00003259384212344A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB3zy5_A0.00003259384212344A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB3zy4_A0.00003259384212344A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB3zy3_B0.00003259384212344A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB3zy3_A0.00003259384212344A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
Transmembrane Domains
StartEnd
1234
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DW5174702671764420
GW89725219541980
FK000039231442740
DW5173972501764250
GO8579223061364410
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00086.1
Arabidopsis lyrata477820
Arabidopsis thalianaAT3G05320.1
Brachypodium distachyonBradi3g05130.1
Brassica rapaBra040646.99.283Bra040646.99.283
Capsella rubellaCarubv10013700mCarubv10013656m
Citrus clementinaCiclev10015216m
Citrus sinensisorange1.1g013043m
Cucumis sativusCucsa.236440.1
Eucalyptus grandisEucgr.H03600.1
Fragaria vescamrna20066.1-v1.0-hybrid
Glycine maxGlyma07g34965.1.189.378Glyma07g34965.1.189.378Glyma07g34965.2.189.378Glyma15g13250.1Glyma20g02800.2
Glyma20g02800.3Glyma09g02350.2Glyma07g34965.2.189.378Glyma09g02350.3Glyma07g34965.3.189.378
Glyma07g34965.3.189.378Glyma07g34965.1.70.189Glyma07g34965.1.70.189Glyma07g34965.2.70.189Glyma07g34965.2.70.189
Glyma07g34965.3.70.189Glyma07g34965.3.70.189
Gossypium raimondiiGorai.009G150500.1.203.398Gorai.011G050000.1Gorai.011G049800.1Gorai.010G169400.1Gorai.010G169400.2
Gorai.009G150500.1.84.201Gorai.009G150500.1.84.201Gorai.009G150500.1.203.398
Linum usitatissimumLus10018291Lus10040618
Malus domesticaMDP0000794968.202.395MDP0000218405.202.395MDP0000218405.202.395MDP0000794968.202.395MDP0000218405.83.200
MDP0000218405.83.200MDP0000794968.83.200MDP0000794968.83.200MDP0000292513
Manihot esculentacassava4.1_007711m
Medicago truncatulaMedtr4g083590.1Medtr2g028900.1
Mimulus guttatusmgv1a024556m.157.260mgv1a024556m.157.260mgv1a010727m
Oryza sativaLOC_Os02g07200.1LOC_Os02g07200.3LOC_Os02g07200.2
Panicum virgatumPavirv00064034mPavirv00047509m
Phaseolus vulgarisPhvul.006G131800.1.76.195Phvul.006G131600.2Phvul.006G131800.1.76.195Phvul.006G131800.1.195.389Phvul.006G131800.1.195.389
Picea abiesMA_458283g0010MA_730174g0010MA_10435476g0010
Populus trichocarpaPotri.015G117500.1Potri.012G118800.1
Prunus persicappa005601m
Ricinus communis30109.m000167
Setaria italicaSi020158m
Selaginella moellendorffii130392.157.337130392.157.337130392.42.158130392.42.158
Sorghum bicolorSb04g004590.1
Thellungiella halophilaThhalv10020752m.197.381Thhalv10020752m.197.381Thhalv10020752m.78.198Thhalv10020752m.78.198
Vitis viniferaGSVIVT01026258001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny