y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.006G183300.1
FamilyCBM57
Protein PropertiesLength: 636 Molecular Weight: 69647.3 Isoelectric Point: 9.2073
ChromosomeChromosome/Scaffold: 06 Start: 29235938 End: 29242359
Descriptionreceptor like protein 4
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM572333645.4e-24
  FGEDSDRPRSVETRIKQASHPPNFYPETLYRSALVSTSNQLDLTYTLDVDPNKNYSVWLHFAEIENSVTAAGQRVFDIMINGDVAFRNVDIVKLSGDRYT
  ALVLNKTVPVNGRTLTVTLSPIKGSFAIISAI
Full Sequence
Protein Sequence     Length: 636     Download
MANIATFGFL LLWTLFLCFA FVSPAAQRGP YGMHISCGAR HDVQTKPTTT LWYKDFGYTG    60
GIPSNASTTS YIAPPLKTLR YFPLSEGLSN CYNINRVPKG RYSIRIFFGL VAQTRVTDEP    120
LFDISIQGTQ IYSLKSGWTS RDDQAFTEAQ VFLKDGSVSI CFHGTGHGDP AILSIEILQI    180
DNNAYYFGPD WSQGVILRTV KRLSCGFGQS KFDVDYGADP RGGDRYWQRI KTFGEDSDRP    240
RSVETRIKQA SHPPNFYPET LYRSALVSTS NQLDLTYTLD VDPNKNYSVW LHFAEIENSV    300
TAAGQRVFDI MINGDVAFRN VDIVKLSGDR YTALVLNKTV PVNGRTLTVT LSPIKGSFAI    360
ISAIEILEVI TAESKTLSDE VMALQTLKKA LGLPPRFGWN GDPCVPQQHP WTGADCRLDK    420
SSSKWVIDGL GLGNQGLKGF LPNDISRLHN LQILNLSGNG IRGAIPSPLG TITSLQVLDL    480
SYNFFNGSIP ESLGQLTSLQ RLNLNGNFLS GRVPATLGGR LLHGASFNFT DNAGLCGIPG    540
LPTCGPHLSA GAKVGIGLGA SFTFLLLIIG SVCWWKRRQN ILRVQQIAGR AAPYAKARTQ    600
FSRDIQMARH NNNTNNNNYG NAHTAVETGP ILLSR*                              660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam11721Malectin0.00331175164+
PLN00113PLN001136.0e-1543051990+
pfam11721Malectin1.0e-17259364118+
pfam12819Malectin_like6.0e-6735369354+
PLN03150PLN03150026634609+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI30598.102463418624unnamed protein product [Vitis vinifera]
RefSeqNP_174156.102663422626AtRLP4 (Receptor Like Protein 4); protein binding [Arabidopsis thaliana]
RefSeqXP_002279791.10336341600PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002305781.10336341596predicted protein [Populus trichocarpa]
RefSeqXP_002509445.101463411629serine-threonine protein kinase, plant-type, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3rgz_A0.00000000000006437551644755A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3rgz_A0.00000004437517478558A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3rgz_A0.0000004424517393486A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3rgz_A0.0000008437518454535A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3rgz_A0.00001437540430532A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
Transmembrane Domains
StartEnd
726
556575
Signal Peptide
Cleavage Site
20
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO8091751812304100
HO809175179552330
HO7902812361033380
FG939605223352570
HO790281223383590.017
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01105.1Aquca_026_00194.1Aquca_036_00074.1
Arabidopsis thalianaAT1G28340.1
Brachypodium distachyonBradi1g26830.1
Brassica rapaBra032897
Carica papayaevm.model.supercontig_27.21
Capsella rubellaCarubv10008578m
Citrus clementinaCiclev10014874mCiclev10014609m
Citrus sinensisorange1.1g013887morange1.1g012913morange1.1g010819morange1.1g009515morange1.1g007860m
orange1.1g007307morange1.1g006793morange1.1g015373morange1.1g009603morange1.1g009236m
orange1.1g006940morange1.1g006035m
Cucumis sativusCucsa.147330.1Cucsa.126850.1
Eucalyptus grandisEucgr.G02346.3Eucgr.E03253.2Eucgr.E03253.1Eucgr.D00605.1
Fragaria vescamrna03872.1-v1.0-hybridmrna29734.1-v1.0-hybrid
Glycine maxGlyma02g11090.2Glyma02g11090.1Glyma01g22406.1Glyma20g32720.1Glyma15g08350.4
Glyma15g08350.3Glyma13g31020.4Glyma13g31020.3Glyma13g24550.1Glyma07g31970.1
Glyma07g31970.2
Gossypium raimondiiGorai.005G138000.3Gorai.005G138000.2Gorai.005G138000.1Gorai.011G029600.2Gorai.011G029600.1
Gorai.006G087900.8Gorai.006G087900.7Gorai.006G087900.6Gorai.006G087900.5Gorai.006G087900.4
Gorai.006G087900.3Gorai.006G087900.2Gorai.006G087900.1
Linum usitatissimumLus10041488Lus10034275Lus10015417Lus10013994Lus10015320
Malus domesticaMDP0000298053MDP0000124675
Manihot esculentacassava4.1_031190mcassava4.1_008047mcassava4.1_003726mcassava4.1_003546mcassava4.1_034042m
Medicago truncatulaMedtr5g053610.1Medtr2g014290.1
Mimulus guttatusmgv1a002935m
Oryza sativaLOC_Os07g31840.1
Panicum virgatumPavirv00022924mPavirv00022923mPavirv00008373m
Physcomitrella patensPp1s83_48V6.1Pp1s199_124V6.1Pp1s5_311V6.1Pp1s1_97V6.1Pp1s2_327V6.1
Pp1s6_364V6.1
Phaseolus vulgarisPhvul.007G102400.1Phvul.003G027500.1Phvul.006G183300.2Phvul.002G230800.1Phvul.003G239400.1
Picea abiesMA_199958g0010MA_41304g0010
Populus trichocarpaPotri.010G129300.3Potri.010G129300.2Potri.010G129300.1Potri.008G117000.2Potri.008G117000.1
Potri.011G056800.2Potri.011G056800.1Potri.004G047300.4Potri.004G047300.3Potri.004G047300.2
Potri.004G047300.1
Prunus persicappa002857mppa003081m
Ricinus communis29738.m00104930190.m011324
Setaria italicaSi029205m
Selaginella moellendorffii133089
Sorghum bicolorSb02g034070.1
Thellungiella halophilaThhalv10007074m
Vitis viniferaGSVIVT01021096001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)