y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.006G215600.1
FamilyGT24
Protein PropertiesLength: 1639 Molecular Weight: 185285 Isoelectric Point: 5.9022
ChromosomeChromosome/Scaffold: 06 Start: 31569425 End: 31587325
DescriptionUDP-glucose:glycoprotein glucosyltransferases;transferases, transferring hexosyl groups;transferases, transferring glycosyl groups
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT24133415810
  INIFSIASGHLYERFLKIMILTVLKNTQRPVKFWFIKNYLSPPFKDLIPRMAQEYGFECELITYKWPTWLHKQNEKQRIIWAYKILFLDVIFPLSLEKVI
  FVDADQIVRTDMGELYDMDIKGKPLAYTPFCDNNKEMDGYRFWRQGFWKDHLRGKPYHISALYVVDLKKFRETAAGDNLRVFYETLSKDPNSLANLDQDL
  PNYAQHVVPIFSLPQEWLWCESWCGNATKSRAKTIDLCNNPMTKEPKL
Full Sequence
Protein Sequence     Length: 1639     Download
MGLRSESPLL LLILILLLAI ASAHTPTPKN VQTSLRAKWF GTPLLLEAGE LLFKEEPRLF    60
WNFIHAWLHA DDHGDAHSHS ARSCVNEILH HSRPLLREPL ASLFEFSLIL RSASPALVLY    120
RQLAHDSLSS HSYAPITKLD PLHLGVSLQS PGGKCCWVDT GDTLFFDVSE LLLWLQTPLE    180
KVGGSIPGPQ LFDFDHVHFD SSVGSPVAVL YGALGTVCFK EFHDALVGAA KQGKVNYILR    240
PVLPAGCETN FGHCGSVGAS ESINLGGYGV ELAFKNMEYK AMDDSTIKKG VTLEDPRTED    300
LSQEVRGFIF SKILERKPEL TYEIMTFRDY LLSSTVSDTL DVWELKDLGH QTVQRIVRAS    360
DPLQSMQDIN QNFPNIVSSL SRMKLDDSVR DEIMANQRMI PPGKSLMAIN GALVNVEDVD    420
LYLLIDLVHQ DLLLADQFSK LKIPPSIVRK LLSTLPPSES SMFRVDFRTT QVHYLNNLEE    480
DAKYKRWRSN LNEILMPVFP GQLRHIRKNL FHAVFVLDPA TISGLEASLF SKANTLFFVN    540
SFSKRNLSFL ELLLGTLQSI DMIISLYESD FPVRFGVVLY SSKYITQLEN LSAKEDRDKF    600
EEDISDMIIR LFSYIKGHHD TQLAFEFLSN VNKLRTESDD GHLELHHVEG AFVETILPKV    660
KSPPQEILLK LEKESELKEL SQESSMLAFK LGLSKTHCSL LMNGLVIDPT EDALLNALND    720
ETQRIQEQVY FGQIKPHTDV LAKFLSEAGI QRYNPRIISD SKPRFVSLSA FLFGEESILN    780
DIEYLHSPGT MDELKPVTHL LAVDITSRSG LHLLRQGLNY LREGSKDARI GLLFSANWST    840
DSLSVLFVKV FEITSSSYSH KKNVLDFLDQ LCLLYQQKYF PTSAVEVEGT QTFIDKVCEL    900
AEANGLPSEG YRPALLKFSA DEVRRHLNKV GIFLHRLLGS ESGVNAVFTN GRVTYPIDES    960
TFLSADLLLL ESIEFKQRTK HILEIIEEVK WQHVDPDMLT SKFISDIVMA VSSSMAVRER    1020
SSESARFEIL NDQHSAIILH NENSSIHIDA CLDPLSATSQ KLSGILRVLW KYIQPSMRIV    1080
LNPLSSLADL PLKNYYRYVV PSMDDFSIAD SSINGPKAFF ANMPLSKTLT MNLDVPEPWL    1140
VEPVIAVHDL DNILLENLGD TRTLQAVFEL EALVLTGHCS EKDHDPPRGL QLILGTKTTP    1200
HLVDTIVMAN LGYWQMKVSP GVWFLQLAPG RSSELYILKE GADGIQSKQL SKLITISDLR    1260
GKVVHMDVVK KKGRENEKLL VSDDEEDPQE TKKGSGWNSN LLKWASGFIS SNEQPKISET    1320
NAEKVKGGRS GKTINIFSIA SGHLYERFLK IMILTVLKNT QRPVKFWFIK NYLSPPFKDL    1380
IPRMAQEYGF ECELITYKWP TWLHKQNEKQ RIIWAYKILF LDVIFPLSLE KVIFVDADQI    1440
VRTDMGELYD MDIKGKPLAY TPFCDNNKEM DGYRFWRQGF WKDHLRGKPY HISALYVVDL    1500
KKFRETAAGD NLRVFYETLS KDPNSLANLD QDLPNYAQHV VPIFSLPQEW LWCESWCGNA    1560
TKSRAKTIDL CNNPMTKEPK LQGARRIVPE WPDLDLEASK FTAQILGDDL EPFPSPNQSK    1620
DLISEDALKE DLESKAEL*                                                 1680
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01501Glyco_transf_81.0e-513381533206+
cd04194GT8_A4GalT_like4.0e-1613341550227+
cd00505Glyco_transf_82.0e-5413341581257+
pfam06427UDP-g_GGTase2.0e-7710051210212+
cd06432GT8_HUGT1_C_like4.0e-17113341581248+
Gene Ontology
GO TermDescription
GO:0003980UDP-glucose:glycoprotein glucosyltransferase activity
GO:0006486protein glycosylation
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAG51883.1091638111674AC016162_4 putative UDP-glucose:glycoprotein glucosyltransferase; 101200-91134 [Arabidopsis thaliana]
GenBankEEE57527.10771611511573hypothetical protein OsJ_07839 [Oryza sativa Japonica Group]
RefSeqNP_177278.3091638111613EBS1 (EMS-mutagenized bri1 suppressor 1); UDP-glucose:glycoprotein glucosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Arabidopsis thaliana]
RefSeqXP_002268972.10141638111611PREDICTED: similar to EBS1 (EMS-MUTAGENIZED BRI1 SUPPRESSOR 1); UDP-glucose:glycoprotein glucosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Vitis vinifera]
RefSeqXP_002529534.101153111499UDP-glucose glycoprotein:glucosyltransferase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
726
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO797114366127516390
HO415354547107616050
HO781411191130114900
HO781411153148716390
HO41535415992010771e-16
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_023_00011.1
Arabidopsis lyrata894960
Arabidopsis thalianaAT1G71220.2AT1G71220.1
Brachypodium distachyonBradi3g28605.1
Brassica rapaBra016154
Capsella rubellaCarubv10022452m
Chlamydomonas reinhardtiig5108.t1g5108.t2
Citrus clementinaCiclev10000024m
Citrus sinensisorange1.1g001078morange1.1g000334morange1.1g000842morange1.1g001779morange1.1g000402m
orange1.1g000446morange1.1g000445m
Cucumis sativusCucsa.033020.2Cucsa.033020.1
Eucalyptus grandisEucgr.H01580.1Eucgr.I02739.1Eucgr.H01552.1.95.175Eucgr.H01552.1.95.175
Fragaria vescamrna11048.1-v1.0-hybrid
Glycine maxGlyma20g20260.1Glyma05g30230.1Glyma08g20020.1Glyma08g20020.2Glyma08g13400.1
Gossypium raimondiiGorai.012G151700.5Gorai.008G027900.1Gorai.012G151700.3Gorai.012G151700.2Gorai.012G151700.4
Linum usitatissimumLus10019946Lus10015475
Malus domesticaMDP0000231077MDP0000439201
Manihot esculentacassava4.1_000150m
Medicago truncatulaMedtr2g006960.1
Mimulus guttatusmgv1a000151m
Oryza sativaLOC_Os02g44510.3LOC_Os02g44510.2LOC_Os02g44510.1
Panicum virgatumPavirv00007561mPavirv00061408m
Physcomitrella patensPp1s25_65V6.1
Picea abiesMA_10435601g0010
Populus trichocarpaPotri.003G018900.1
Prunus persicappa000323m
Ricinus communis29222.m000396
Setaria italicaSi033881m
Selaginella moellendorffii186368
Sorghum bicolorSb04g036540.1
Thellungiella halophilaThhalv10018004m
Vitis viniferaGSVIVT01022867001
Volvox carteriVocar20012786m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny