y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.007G004900.2
FamilyGT48
Protein PropertiesLength: 1900 Molecular Weight: 218053 Isoelectric Point: 8.5409
ChromosomeChromosome/Scaffold: 07 Start: 343866 End: 377271
Descriptionglucan synthase-like 10
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT48102217540
  IPKNLEARRRLQFFTNSLFMKMPVAKPVREMLSFSVFTPYYSEIVLYSMAELLKKNEDGISILFYLQKIYPDEWKNFLARIGRDENSSESELNDNSSDIL
  ELRFWASYRGQTLARTVRGMMYYRKALMLQTYLERSTTGDLEAAVGCDEVTDTHGFELSPEARAQADLKFTYVVTCQIYGKQKEEQKPEAADIALLMQRN
  EALRVAFIDVVETLKEGKVNTEYYSKLVKADVNGKDKEIYSVKLPGNPKLGEGKPENQNHAVIFTRGNAIQTIDMNQDNYFEEALKMRNLLEEFHSNHGL
  RPPTILGVREHVFTGSVSSLASFMSNQETSFVTMGQRVLASPLKVRMHYGHPDVFDRIFHITRGGISKASRVINISEDIYSGFNSTLRQGNVTHHEYIQV
  GKGRDVGLNQIALFEGKVSGGNGEQVLSRDVYRLGQLFDFFRMMSFYFTTVGYYFCTMLTVLTVYAFLYGKIYLALSGVGETIIDRAKITGNTALSAALN
  TQFLFQIGIFTAVPMILGFILEQGFLRAIVSFVTMQFQLCTVFFTFSLGTRTHYFGRTILHGGARYQATGRGFVVRHIKFSENYRLYSRSHFVKGLEVAL
  LLIVYLAYGYNEGGALSYILLSISSWFMALSWLFAPYLFNPSGFEWQKVVEDFRDWTNWLLYRGGIGVKGEESWEAWWEEELAHIKSLGSRIAETILSLR
  FFIFQYGIVYKLNVKGTSTSLTVYGLSWVVLAV
Full Sequence
Protein Sequence     Length: 1900     Download
MSRAEELWER LVRAALRRER TGDDAYGRPV GGIAGNVPSA LAKNRDIDEI LRVADEIQED    60
DPSVSRILCE HAYSLSQNLD PNSEGRGVLQ FKTGLMSVIK QKLAKREAGT IDRSQDVARL    120
QEFYRIYREK NNVDKLREEE TKLRESGAFS RDLGELERKT VKRKRVFATL KVLGTVLEQL    180
SEEIPAELKR VMDSDSALTE DLIAYNIIPL DTSSSTNAIV LLPEVQAAVS ALKYFDGLPE    240
LPRGYFIPPS RSTNVFDFLQ CIFGFQKDNV ANQHENIVHL LANEQSRLRI PDEAEPKLDE    300
AAVQAVFLKS LQNYINWCSY LRIQPVWSSL EALSKEKKIL YVSLYFLIWG EAANIRFLAE    360
CLCYIFHHMA REMDEILRQH IAQPANSCTS DSVDGVSFLD NVIFPLYDIV SAEAANNDNG    420
KAPHSSWRNY DDFNEYFWSL KCFDLSWPWR TTSPFFQKPL PRSKKMLISG SSRHQGKTSF    480
VEHRTFFHLY HSFHRLWIFL FMMFQGLAIV AFNDEKFNGK TLREVLSLGP TFFVMKFFES    540
VLDIFMMYGA YSTTRRTAIT RIFLRFLWFS GASVFLSFIY VKALQEESKA NGNSVVFRLY    600
VIIIGIYAGV QFFISFLMRI PACHRLTNQC DQWSFIRLVK WLRQERHYVG RGMYERSADF    660
IKYMFFWLVI LSAKFAFAYF LQIRPLVGPT RDIIKETNIV YSWHDFVSKN NHNALTVASV    720
WAPVIAIYLL DIHVFYTLVS AVWGFLLGAR DRLGEIRSLE AVHKLFEQFP GAFMGTLHVP    780
LTNRSSHQSS VQVDAARFAP FWNEIIRNLR EEDYVTNFEM ELLLMPKNSG DLPMVQWPLF    840
LLSSKIFLAR DIAVESKDTQ DELWDRISRD DYMMYAVQEC YYAIKFILIE ILDDVGRKWV    900
ERIYDDINSS ITKRSIHLDI NLHKLALVIS RVTALMGILR ETETPELERG AVRAIQDLYD    960
VMRLDVIPIN MRENYETWSL LTKARNEGHL FEKLKWPKNT DLKMQVRRLY SLLTIKESAS    1020
SIPKNLEARR RLQFFTNSLF MKMPVAKPVR EMLSFSVFTP YYSEIVLYSM AELLKKNEDG    1080
ISILFYLQKI YPDEWKNFLA RIGRDENSSE SELNDNSSDI LELRFWASYR GQTLARTVRG    1140
MMYYRKALML QTYLERSTTG DLEAAVGCDE VTDTHGFELS PEARAQADLK FTYVVTCQIY    1200
GKQKEEQKPE AADIALLMQR NEALRVAFID VVETLKEGKV NTEYYSKLVK ADVNGKDKEI    1260
YSVKLPGNPK LGEGKPENQN HAVIFTRGNA IQTIDMNQDN YFEEALKMRN LLEEFHSNHG    1320
LRPPTILGVR EHVFTGSVSS LASFMSNQET SFVTMGQRVL ASPLKVRMHY GHPDVFDRIF    1380
HITRGGISKA SRVINISEDI YSGFNSTLRQ GNVTHHEYIQ VGKGRDVGLN QIALFEGKVS    1440
GGNGEQVLSR DVYRLGQLFD FFRMMSFYFT TVGYYFCTML TVLTVYAFLY GKIYLALSGV    1500
GETIIDRAKI TGNTALSAAL NTQFLFQIGI FTAVPMILGF ILEQGFLRAI VSFVTMQFQL    1560
CTVFFTFSLG TRTHYFGRTI LHGGARYQAT GRGFVVRHIK FSENYRLYSR SHFVKGLEVA    1620
LLLIVYLAYG YNEGGALSYI LLSISSWFMA LSWLFAPYLF NPSGFEWQKV VEDFRDWTNW    1680
LLYRGGIGVK GEESWEAWWE EELAHIKSLG SRIAETILSL RFFIFQYGIV YKLNVKGTST    1740
SLTVYGLSWV VLAVLIILFK VFTFSQKISV NFQLLLRFIQ GVSLLLALAG LVVAVILTDL    1800
SLPDIFASIL AFIPTGWGIL SIAAAWKPLM KKLGLWKSVR SIARLYDAGM GMLIFVPIAF    1860
FSWFPFVSTF QTRLMFNQAF SRGLEISLIL AGNNPNTGI*                          1920
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam14288FKS1_dom11.0e-49336450116+
pfam02364Glucan_synthase010201764824+
Gene Ontology
GO TermDescription
GO:00001481,3-beta-D-glucan synthase complex
GO:00038431,3-beta-D-glucan synthase activity
GO:0006075(1->3)-beta-D-glucan biosynthetic process
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAD25952.101189911899AF085717_1 putative callose synthase catalytic subunit [Gossypium hirsutum]
RefSeqNP_187372.401189911941ATGSL10 (glucan synthase-like 10); 1,3-beta-glucan synthase [Arabidopsis thaliana]
Swiss-ProtQ9SFU601189911931CALS9_ARATH RecName: Full=Callose synthase 9; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 10
RefSeqXP_002285644.101189911905PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002528123.1011899119141,3-beta-glucan synthase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
493512
525547
562584
596618
663681
717739
14671489
15171539
15491571
16071629
16391661
17081730
17401762
17741796
18061825
18451867
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO780746506105215570
HO80183428579210760
HO801834194107512680
HO796781413148819000
HS383332395120716010
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_056_00094.1Aquca_014_00906.1Aquca_019_00181.4Aquca_019_00181.3Aquca_019_00181.1
Aquca_016_00166.1Aquca_019_00181.2Aquca_084_00016.4Aquca_084_00016.3Aquca_084_00016.2
Aquca_084_00016.1Aquca_022_00132.2Aquca_022_00132.1Aquca_014_00908.4Aquca_014_00908.3
Aquca_014_00908.2Aquca_014_00908.1Aquca_014_00908.5Aquca_008_00266.1Aquca_039_00091.4
Aquca_039_00091.2Aquca_039_00091.1Aquca_039_00091.3Aquca_056_00094.2
Arabidopsis lyrata340908482666470669899601907409
878725482124490214490142897726
325786
Arabidopsis thalianaAT3G07160.1AT2G36850.1AT1G06490.1AT4G03550.1AT2G13680.1
AT1G05570.2AT1G05570.1AT4G04970.1AT3G59100.1AT2G31960.2
AT2G31960.1AT5G13000.1AT5G13000.2AT3G14570.2AT3G14570.1
AT5G36870.1
Brachypodium distachyonBradi1g51757.1Bradi1g77247.2Bradi1g77247.1Bradi1g47427.1Bradi2g50140.1
Bradi3g60790.2Bradi3g60790.1Bradi1g29622.1Bradi1g76617.1Bradi2g46250.1
Bradi2g40460.1Bradi3g09317.1Bradi2g40430.1
Brassica rapaBra005239Bra029628Bra001239Bra040364Bra015504
Bra034218Bra032416Bra037213Bra029541Bra015436
Bra003364Bra023386Bra008864Bra005624Bra027328
Carica papayaevm.model.supercontig_42.151evm.model.supercontig_189.7evm.model.supercontig_25.167evm.model.supercontig_858.3evm.model.supercontig_2050.2
evm.model.supercontig_3407.1evm.model.supercontig_50.100evm.model.supercontig_4.57
Capsella rubellaCarubv10022498mCarubv10022499m
Citrus clementinaCiclev10014066mCiclev10018457mCiclev10018456mCiclev10000018mCiclev10018223m
Ciclev10030477mCiclev10030476mCiclev10014015mCiclev10030481mCiclev10030478m
Ciclev10030495mCiclev10024186mCiclev10030599mCiclev10030560mCiclev10030796m
Citrus sinensisorange1.1g000946morange1.1g000813morange1.1g000382morange1.1g000253morange1.1g000219m
orange1.1g000179morange1.1g000260morange1.1g000273morange1.1g000180morange1.1g000261m
orange1.1g045737morange1.1g000259morange1.1g000258morange1.1g001004morange1.1g000585m
orange1.1g000171morange1.1g000349morange1.1g000165morange1.1g001473morange1.1g000389m
orange1.1g000385morange1.1g040336morange1.1g000763m
Cucumis sativusCucsa.157510.4Cucsa.157510.3Cucsa.157510.2Cucsa.157510.1Cucsa.142920.1
Cucsa.249900.1Cucsa.119100.1Cucsa.126670.1Cucsa.239610.1Cucsa.049980.10
Cucsa.142930.1Cucsa.049980.1Cucsa.058220.1Cucsa.058230.1
Eucalyptus grandisEucgr.B00160.1Eucgr.B03640.2Eucgr.B03640.1Eucgr.I00208.1Eucgr.K01028.4
Eucgr.K01028.3Eucgr.K01028.2Eucgr.K01028.1Eucgr.D00621.1Eucgr.A01821.1
Eucgr.K01027.1Eucgr.D00622.1Eucgr.J00836.1Eucgr.J00827.1Eucgr.F01403.1
Eucgr.A01827.1Eucgr.A02008.1Eucgr.A01817.1Eucgr.A01994.2Eucgr.A01994.1
Eucgr.A02010.1Eucgr.J00836.2Eucgr.A01997.1
Fragaria vescamrna09912.1-v1.0-hybridmrna17912.1-v1.0-hybridmrna17710.1-v1.0-hybridmrna28731.1-v1.0-hybridmrna02397.1-v1.0-hybrid
mrna24411.1-v1.0-hybridmrna26782.1-v1.0-hybridmrna28728.1-v1.0-hybrid.526.840mrna28728.1-v1.0-hybrid.526.840
Glycine maxGlyma06g18216.1Glyma04g36725.1Glyma20g38860.1Glyma10g44150.1Glyma05g32500.4
Glyma05g32500.3Glyma05g32500.2Glyma08g16660.1Glyma04g39120.2Glyma04g39120.1
Glyma13g37290.2Glyma08g42150.3Glyma08g42150.2Glyma08g42150.1Glyma18g12870.3
Glyma18g12870.2Glyma18g12870.1Glyma15g08020.3Glyma15g08020.2Glyma15g08020.1
Glyma15g42330.4Glyma15g42330.3Glyma15g42330.2Glyma18g53823.1Glyma08g47670.1
Glyma08g47670.2Glyma18g13105.9Glyma18g13105.8Glyma18g13105.7Glyma18g13105.6
Glyma18g13105.10Glyma18g13105.3Glyma18g13105.2Glyma18g13105.1Glyma18g13105.5
Glyma18g13105.4Glyma15g39420.2Glyma13g33560.1Glyma05g32500.6Glyma05g32500.5
Glyma08g42110.1Glyma06g44770.3Glyma06g44770.2Glyma13g31310.1Glyma06g44770.4
Glyma10g44150.2Glyma08g16715.1Glyma06g15860.1.320.682Glyma06g15860.1.320.682Glyma08g16730.2
Gossypium raimondiiGorai.004G018200.3Gorai.004G018200.1Gorai.004G018200.2Gorai.003G109000.6Gorai.003G109000.1
Gorai.003G109000.2Gorai.003G109000.3Gorai.003G109000.4Gorai.011G120300.1Gorai.005G201500.2
Gorai.005G201500.1Gorai.011G119900.1Gorai.013G075600.1Gorai.004G092500.3Gorai.004G092500.2
Gorai.004G092500.1Gorai.011G096900.3Gorai.011G096900.1Gorai.004G092600.3Gorai.004G092600.1
Gorai.009G169700.3Gorai.009G169700.2Gorai.009G169700.1Gorai.012G187400.3Gorai.012G187400.2
Gorai.012G187400.1Gorai.004G092600.2Gorai.004G092600.4Gorai.012G040000.2Gorai.012G040000.1
Gorai.005G042700.1Gorai.005G043100.1Gorai.012G128700.1Gorai.007G334800.1Gorai.007G334800.2
Gorai.003G109000.5
Linum usitatissimumLus10014796Lus10032463Lus10039828Lus10000266Lus10031648
Lus10033689Lus10001424Lus10001056Lus10003920Lus10039199
Lus10037469Lus10013744Lus10033483Lus10007327Lus10030030
Lus10042478Lus10020893Lus10020750Lus10040891.301.669Lus10040891.301.669
Lus10002096Lus10002097
Malus domesticaMDP0000174437MDP0000286691MDP0000245319MDP0000275961MDP0000915307
MDP0000229527MDP0000230907MDP0000203763MDP0000321472MDP0000220467
MDP0000308574MDP0000198973MDP0000230621MDP0000212172.415.839MDP0000212172.415.839
MDP0000372473MDP0000310065MDP0000213931MDP0000218486.624.863MDP0000218486.624.863
MDP0000218486.624.863
Manihot esculentacassava4.1_001919mcassava4.1_031653mcassava4.1_029201mcassava4.1_000111mcassava4.1_000342m
cassava4.1_000112mcassava4.1_000082mcassava4.1_026004mcassava4.1_002527mcassava4.1_003374m
cassava4.1_003342mcassava4.1_006866mcassava4.1_028751mcassava4.1_033421m
Medicago truncatulaMedtr4g078220.1Medtr3g047390.1Medtr7g005950.1Medtr1g116370.1AC235753_1023.1
Medtr1g116470.1.521.981Medtr1g116470.1.521.981Medtr1g116470.1.228.504Medtr1g116470.1.228.504
Mimulus guttatusmgv1a000080mmgv1a000075mmgv1a000084mmgv1a000082mmgv1a000070m
mgv1a000067mmgv1a000108mmgv1a024191mmgv1a000066mmgv1a000106m
mgv1a000068m
Oryza sativaLOC_Os06g08380.1LOC_Os02g58560.1LOC_Os01g55040.1LOC_Os06g51270.1LOC_Os03g03610.3
LOC_Os03g03610.2LOC_Os03g03610.1LOC_Os02g58560.3LOC_Os02g14900.1LOC_Os01g34930.1
LOC_Os01g48200.1LOC_Os01g34890.1LOC_Os01g34880.1
Panicum virgatumPavirv00009928mPavirv00009617mPavirv00009495mPavirv00057448mPavirv00022973m
Pavirv00045342mPavirv00015084mPavirv00020404mPavirv00041942mPavirv00010502m
Pavirv00026821mPavirv00007196mPavirv00061397mPavirv00045035mPavirv00040188m
Pavirv00056028mPavirv00049749mPavirv00048524mPavirv00058599m
Physcomitrella patensPp1s88_136V6.1Pp1s160_88V6.1Pp1s40_186V6.2Pp1s67_234V6.1Pp1s67_70V6.1
Pp1s145_49V6.1Pp1s18_300V6.2Pp1s199_13V6.1Pp1s13_132V6.1Pp1s13_432V6.1
Pp1s379_24V6.1Pp1s66_72V6.1
Phaseolus vulgarisPhvul.007G004900.1Phvul.007G004900.3Phvul.002G272000.1Phvul.009G150300.2Phvul.009G150300.1
Phvul.011G113800.1Phvul.006G185600.2Phvul.006G185600.1Phvul.006G032100.1Phvul.006G031900.1
Phvul.005G103600.1Phvul.008G002300.1Phvul.005G040900.2Phvul.007G005100.1Phvul.005G040900.1
Phvul.005G062500.1Phvul.009G169400.1
Picea abiesMA_10428413g0040MA_826577g0010MA_960362g0010MA_10426974g0030MA_735748g0010
MA_6205g0020MA_10426974g0020MA_10430560g0010MA_10431062g0010MA_229544g0010
MA_10434444g0010MA_10431631g0010
Populus trichocarpaPotri.015G089300.1Potri.001G011900.1Potri.005G058300.2Potri.005G058300.1Potri.013G131300.1
Potri.001G230000.9Potri.001G230000.8Potri.001G230000.7Potri.001G230000.6Potri.001G230000.5
Potri.001G230000.4Potri.001G230000.3Potri.001G230000.2Potri.001G230000.17Potri.001G230000.16
Potri.011G052400.6Potri.011G052400.5Potri.011G052400.4Potri.011G052400.3Potri.011G052400.2
Potri.011G052400.1Potri.002G058700.3Potri.002G058700.2Potri.002G058700.1Potri.001G012200.3
Potri.001G012200.1Potri.001G012200.2Potri.005G203500.2Potri.005G203500.1Potri.003G214200.2
Potri.003G214200.1Potri.011G095100.2Potri.011G095100.1Potri.001G230000.10Potri.001G230000.18
Potri.001G012200.5Potri.001G012200.4Potri.005G203500.3Potri.001G230000.11Potri.001G230000.12
Potri.001G230000.13
Prunus persicappa000071mppa000167mppa000077mppa000074mppa001863m
ppa000121mppa000112mppa002267mppa000073mppa003008m
ppa000306m
Ricinus communis30147.m01381228035.m00035829691.m00028229983.m00319129734.m000419
28035.m00035929759.m00028130226.m00202329983.m00319229851.m002416
Setaria italicaSi033860mSi034369mSi034352mSi008368mSi016068m
Si016067mSi000021mSi000023mSi000022mSi000017m
Si033956mSi033893mSi033872mSi016150mSi000059m
Selaginella moellendorffii133452439692163802267830177798
449402
Sorghum bicolorSb10g005550.1Sb04g038510.1Sb10g030970.1Sb01g048630.1Sb03g023490.1
Sb03g030800.1Sb03g034880.1Sb04g008830.1
Thellungiella halophilaThhalv10019878mThhalv10016126mThhalv10006529mThhalv10022518mThhalv10028360m
Thhalv10028359mThhalv10006533mThhalv10006528mThhalv10016125mThhalv10012412m
Thhalv10005734mThhalv10019876mThhalv10029222m
Vitis viniferaGSVIVT01025370001GSVIVT01007560001GSVIVT01026489001GSVIVT01001361001GSVIVT01020854001
GSVIVT01025362001GSVIVT01000622001GSVIVT01005204001GSVIVT01020548001.494.863GSVIVT01020548001.494.863
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)