y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.007G009300.1
FamilyPL1
Protein PropertiesLength: 335 Molecular Weight: 37572.6 Isoelectric Point: 7.4414
ChromosomeChromosome/Scaffold: 07 Start: 656464 End: 659794
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL1642430
  IVFEVSGTIQLSSYLSVSSYKTIDGRGQRVKLTGKGLRLKECEHIIVCNLEFEGGRGHDVDGIQIKPNSRHIWIDRCTLRDYDDGLIDITRQSTDITVSR
  CCFGQHDKTMLIGADPTHVGDRCIRVTIHHCFFDGTRQRQPRVRFGKVHLYNNYTRNWTVYAVCASVESQIYSQCNIYEA
Full Sequence
Protein Sequence     Length: 335     Download
MAGIQMLPYG DVDSNLRAMA GRAEGFGRHA IGGLNGSLYL VTTLADDGPG SLREGCRRIE    60
PLWIVFEVSG TIQLSSYLSV SSYKTIDGRG QRVKLTGKGL RLKECEHIIV CNLEFEGGRG    120
HDVDGIQIKP NSRHIWIDRC TLRDYDDGLI DITRQSTDIT VSRCCFGQHD KTMLIGADPT    180
HVGDRCIRVT IHHCFFDGTR QRQPRVRFGK VHLYNNYTRN WTVYAVCASV ESQIYSQCNI    240
YEAGTKKKTF EFYTEKAADK EEQKSGSIVS EGDILLNGAQ PCLVTQNREV AMFHPSEYYS    300
TWTMEAAAHS LREVLQLCTG WQSICRPVDR MVLN*                               360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00544Pec_lyase_C6.0e-3965239195+
COG3866PelB6.0e-4432244232+
smart00656Amb_all9.0e-6778244179+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK93648.10733258383unknown [Populus trichocarpa]
EMBLCAB75748.1073324339pectate lyase-like protein [Arabidopsis thaliana]
RefSeqNP_191074.2073324329pectate lyase family protein [Arabidopsis thaliana]
RefSeqXP_002311134.1043281325predicted protein [Populus trichocarpa]
RefSeqXP_002526780.1073154312Pectate lyase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B3e-401330715335A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A3e-401330715335A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB3zsc_A2e-283124122246A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB1vbl_A3e-2680241130330A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB3vmw_A3e-206024246247A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG177860305243280
DY27528233073350
DW066041301283280
DY27727531073160
DY277275303063350.081
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_027_00219.1.467.641Aquca_027_00219.1.467.641Aquca_027_00219.1.123.302Aquca_027_00219.1.123.302Aquca_027_00219.2.123.302
Aquca_027_00219.2.123.302Aquca_027_00219.3Aquca_027_00219.2.467.633Aquca_027_00219.2.467.633
Arabidopsis lyrata485935478272
Arabidopsis thalianaAT3G55140.1AT3G55140.2AT3G09540.1
Brachypodium distachyonBradi1g22147.1Bradi2g54350.1
Brassica rapaBra029773Bra014772
Capsella rubellaCarubv10014016mCarubv10017857mCarubv10017611m
Citrus clementinaCiclev10012162mCiclev10032073mCiclev10032345mCiclev10012161mCiclev10011951m
Citrus sinensisorange1.1g016742morange1.1g016766morange1.1g017111morange1.1g017716morange1.1g020048m
orange1.1g020121morange1.1g022635morange1.1g023514morange1.1g024841m
Cucumis sativusCucsa.065830.2Cucsa.065830.1
Eucalyptus grandisEucgr.J01160.1Eucgr.A01218.1Eucgr.A01218.2Eucgr.J01160.2
Fragaria vescamrna18180.1-v1.0-hybridmrna23375.1-v1.0-hybrid
Glycine maxGlyma20g38490.1Glyma10g05290.2Glyma13g19670.2
Gossypium raimondiiGorai.011G245200.2Gorai.011G245200.1Gorai.006G176400.1
Linum usitatissimumLus10030313Lus10003307Lus10025290Lus10024439
Malus domesticaMDP0000302815MDP0000319235MDP0000259620MDP0000215346MDP0000196711
MDP0000322627
Manihot esculentacassava4.1_010014mcassava4.1_030620m
Mimulus guttatusmgv1a009885mmgv1a008720m
Oryza sativaLOC_Os01g62000.1LOC_Os01g36620.1
Panicum virgatumPavirv00008711mPavirv00047085mPavirv00064103m
Physcomitrella patensPp1s37_38V6.3Pp1s37_38V6.4Pp1s37_38V6.2Pp1s37_38V6.1
Phaseolus vulgarisPhvul.007G160100.1
Picea abiesMA_10426401g0010
Populus trichocarpaPotri.006G214400.1Potri.016G080600.1Potri.008G048600.1
Prunus persicappa008409mppa007270m
Ricinus communis29690.m00040929469.m000051
Setaria italicaSi004466mSi010447m
Selaginella moellendorffii93746412910
Sorghum bicolorSb03g039150.1Sb08g004905.1
Thellungiella halophilaThhalv10020972mThhalv10010534m
Vitis viniferaGSVIVT01025593001GSVIVT01005974001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)