y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.007G038200.1
FamilyAA1
Protein PropertiesLength: 572 Molecular Weight: 64836 Isoelectric Point: 7.919
ChromosomeChromosome/Scaffold: 07 Start: 3054095 End: 3058509
DescriptionCupredoxin superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1893561.2e-24
  ATVPGPTIEALHGVDLHVRWQNHLPPHHILPWDPTIPTAITNTTPGIPTVVHLHGGIHGPESDGNANSWFISKFKETGPTWSRKTYHYPNNQQPGNLWYH
  DHAMGLTRVNLLAGLLGSYIIREPAVEDPLGLPSGDEFDRPLVVFDRSFRTDGSLFMNSTGNNPDIHPQWVPEYFGDAIIVNGKAWPRLTVRRRKYRFRI
  INASNARFFKFFFSNGLRFTHVASDSAYIEKPVTTNEILVGPSEITDVIVDFSQSKTNVAILANGAKF
Full Sequence
Protein Sequence     Length: 572     Download
MDRTLLLKLL TLVAFLGCSS ALDHLVNLSK LEMFVDELPD MPRIHGYHVF NGVPKPKSIK    60
IGMFKKKWKF HRDLPPTTVY AFGTTKHKAT VPGPTIEALH GVDLHVRWQN HLPPHHILPW    120
DPTIPTAITN TTPGIPTVVH LHGGIHGPES DGNANSWFIS KFKETGPTWS RKTYHYPNNQ    180
QPGNLWYHDH AMGLTRVNLL AGLLGSYIIR EPAVEDPLGL PSGDEFDRPL VVFDRSFRTD    240
GSLFMNSTGN NPDIHPQWVP EYFGDAIIVN GKAWPRLTVR RRKYRFRIIN ASNARFFKFF    300
FSNGLRFTHV ASDSAYIEKP VTTNEILVGP SEITDVIVDF SQSKTNVAIL ANGAKFPYPS    360
GDPVNEDNGK VMKFIILPDR EVDTSRIPRR LVEYPAADLS SVTHTRYVAM YEYTTEDDEP    420
THLYLNAKPY DAPVTETPRV GSTEVWYVIN LTEDNHPLHI HLGLFRVLDQ TALVKADEFT    480
ECMTKKNDAV QCHLQKHVRG KKVAVEDHEK GWKNVFKMIP GHVTKIAVRF SHIHNNESYA    540
FDATAEPGYI YHCHVLDHED NAMMRPLKLV K*                                  600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00394Cu-oxidase7.0e-11256352101+
PRK10965PRK109653.0e-11425564144+
PRK10883PRK108833.0e-14177351182+
PRK10965PRK109651.0e-15179406236+
COG2132SufI1.0e-3871567505+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN78466.102357125573hypothetical protein [Vitis vinifera]
EMBLCBI26921.1023571106654unnamed protein product [Vitis vinifera]
RefSeqXP_002284144.101457120577PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315892.102357025572predicted protein [Populus trichocarpa]
RefSeqXP_002531069.1015711575spore coat protein, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3zdw_A0315703509A Chain A, Crystal Structure Of Calcium-Free (Or Apo) Human S100a6; Cys3met Mutant (Selenomethionine Derivati
PDB2x88_A0315703509A Chain A, Crystal Structure Of Calcium-Free (Or Apo) Human S100a6; Cys3met Mutant (Selenomethionine Derivati
PDB2x87_A0315703509A Chain A, Crystal Structure Of The Reconstituted Cota
PDB2bhf_A0315703509A Chain A, Crystal Structure Of The Reconstituted Cota
PDB1w8e_A0315703509A Chain A, Crystal Structure Of The Reconstituted Cota
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778093519545720
HO7965214581155720
FE7109032532094610
EY7055082941524450
EL4671113072525580
Orthologous Group
SpeciesID
Arabidopsis lyrata472551
Brassica rapaBra024558Bra016163
Carica papayaevm.model.supercontig_65.123
Capsella rubellaCarubv10020039m
Eucalyptus grandisEucgr.B00864.1Eucgr.B00863.1Eucgr.B00862.1
Glycine maxGlyma20g26270.3Glyma20g26270.2Glyma20g26270.1Glyma10g41010.1
Gossypium raimondiiGorai.005G162700.1
Manihot esculentacassava4.1_004784m
Mimulus guttatusmgv1a004781m
Oryza sativaLOC_Os01g03640.1LOC_Os01g03630.1LOC_Os01g03620.1LOC_Os01g03530.2LOC_Os01g03530.1
Panicum virgatumPavirv00060261mPavirv00051027mPavirv00039074m
Physcomitrella patensPp1s40_48V6.1Pp1s40_48V6.2Pp1s40_48V6.3Pp1s40_48V6.4Pp1s40_48V6.5
Pp1s40_48V6.6
Picea abiesMA_64691g0010MA_10432589g0010
Setaria italicaSi005198mSi004323m
Selaginella moellendorffii90700
Sorghum bicolorSb03g007440.1
Thellungiella halophilaThhalv10007182m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny