y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.007G045500.1
FamilyGH10
Protein PropertiesLength: 568 Molecular Weight: 63196.8 Isoelectric Point: 6.7979
ChromosomeChromosome/Scaffold: 07 Start: 3604059 End: 3608344
DescriptionGlycosyl hydrolase family 10 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH102174980
  KLNFPFGCGMNHFILTSKDYQNWFASRFKFTTFTNEMKWYSTERIQGQEDYSIADAMLSFAKVKGISVRGHNILWDNEKQQPQWIKTLSPEDLKKAVAKR
  IRSVVSRYKGQVIAWDVMNENLHFHFFEDNLGQNASAQAYAATFALDPGTQMFLNDFNTIEFSGDKLASPVKYIQKVKEILSFPGVAGMSLAIGLQGHFA
  VGQPNLAYMRSSLDLLATTGLSIWLTEVSVDPQPSQAEYLEDVLREAYSHPAVDGIIMFSGPAQAGFNTTTLADENFRNTPA
Full Sequence
Protein Sequence     Length: 568     Download
MKVCAEGCNS LFITIFLLLI SGYGVHSFSY HYSATTDCIA EAERAEYGGG IIVNPGFDEN    60
IEGISNEGNR FIVAHNREQP LDSFSQKLQL RKGMLYTFSG WFQVSEGSDT VSVMFRAKGN    120
ELIRGGQVMA KHGCWTLLKG GITANFSSTV EILFESKNSS VEIWADNISL QPFSKKQWRS    180
LQNASIEKVR MRKVRFQVTD ENGTALNGAK VITKGAKLNF PFGCGMNHFI LTSKDYQNWF    240
ASRFKFTTFT NEMKWYSTER IQGQEDYSIA DAMLSFAKVK GISVRGHNIL WDNEKQQPQW    300
IKTLSPEDLK KAVAKRIRSV VSRYKGQVIA WDVMNENLHF HFFEDNLGQN ASAQAYAATF    360
ALDPGTQMFL NDFNTIEFSG DKLASPVKYI QKVKEILSFP GVAGMSLAIG LQGHFAVGQP    420
NLAYMRSSLD LLATTGLSIW LTEVSVDPQP SQAEYLEDVL REAYSHPAVD GIIMFSGPAQ    480
AGFNTTTLAD ENFRNTPAGD VVDKLIQEWG TEPKIAAADG RGIVDISLHH GDYDVTVTHP    540
LIHSPITMNL SVKKDFSLET IHVKMRT*                                       600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3693XynA3.0e-30251465225+
pfam00331Glyco_hydro_102.0e-55216502310+
smart00633Glyco_105.0e-76253502273+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU19437.1015661580unknown [Glycine max]
RefSeqXP_002313181.102556520573predicted protein [Populus trichocarpa]
RefSeqXP_002313183.10625633506predicted protein [Populus trichocarpa]
RefSeqXP_002532419.10385558537hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis]
RefSeqXP_002532422.103856523562hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1nq6_A3e-2322250215298A Chain A, Crystal Structure Of The Catalytic Domain Of Xylanase A From Streptomyces Halstedii Jm8
PDB1xas_A3e-2322245116244A Chain A, Crystal Structure, At 2.6 Angstroms Resolution, Of The Streptomyces Lividans Xylanase A, A Member Of The F Family Of Beta-1,4-D-Glycanses
PDB1v0n_A4e-2322245116244A Chain A, Crystal Structure, At 2.6 Angstroms Resolution, Of The Streptomyces Lividans Xylanase A, A Member Of The F Family Of Beta-1,4-D-Glycanses
PDB1v0m_A4e-2322245116244A Chain A, Crystal Structure, At 2.6 Angstroms Resolution, Of The Streptomyces Lividans Xylanase A, A Member Of The F Family Of Beta-1,4-D-Glycanses
PDB1v0l_A4e-2322245116244A Chain A, Crystal Structure, At 2.6 Angstroms Resolution, Of The Streptomyces Lividans Xylanase A, A Member Of The F Family Of Beta-1,4-D-Glycanses
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FG9957912403295680
EX52952231813040
CA900287215622760
ES8308062891033890
ES830806893914770.5
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00095.4.344.628Aquca_017_00095.3.344.628Aquca_017_00095.2.564.848Aquca_017_00095.1.577.861Aquca_006_00211.1
Aquca_003_00413.1Aquca_011_00218.1.200.461Aquca_011_00219.1.223.486Aquca_006_00211.2
Arabidopsis lyrata475392.571.844489729.403.684490628913024.223.481491296
491295.221.480353449353450480358
Arabidopsis thalianaAT1G58370.1.570.844AT4G08160.1.404.685AT4G08160.2.404.657AT4G38650.1AT4G38300.1
AT4G33830.1.222.485AT4G33840.1.222.480AT4G33860.1.222.480AT4G33820.1AT4G33810.1
AT2G14690.1
Brachypodium distachyonBradi1g12710.1.410.670Bradi2g02320.1.243.531Bradi2g02330.1Bradi1g27257.1.195.481Bradi5g04640.1
Bradi1g68310.1Bradi3g24410.1Bradi1g71040.1.232.494Bradi1g71076.1Bradi1g71050.1
Brassica rapaBra031698.712.996Bra027867.572.849Bra039768.635.918Bra010733Bra017609.315.575
Bra034585.221.481Bra034584.220.481Bra034586Bra036392Bra017610
Carica papayaevm.model.supercontig_160.18.423.706evm.model.supercontig_160.19.570.841evm.model.supercontig_37.165evm.model.supercontig_106.45.230.491evm.model.supercontig_169.45
evm.model.supercontig_106.44
Capsella rubellaCarubv10008217m.613.898Carubv10019737m.593.868Carubv10000293m.404.688Carubv10004489mCarubv10004963m
Carubv10006586m.221.480Carubv10006745mCarubv10004408mCarubv10015996m
Citrus clementinaCiclev10000171m.611.880Ciclev10030219mCiclev10028121mCiclev10030382m.227.489Ciclev10028089m
Citrus sinensisorange1.1g002447m.574.843orange1.1g036715morange1.1g035723morange1.1g042396morange1.1g008838m
Cucumis sativusCucsa.353160.7.566.835Cucsa.353160.4.599.868Cucsa.353160.1.599.868Cucsa.353160.8.341.611Cucsa.143690.1.601.869
Cucsa.169000.1Cucsa.219120.1Cucsa.298380.1
Eucalyptus grandisEucgr.F00109.1.537.816Eucgr.F00108.3.544.819Eucgr.F00108.2.583.858Eucgr.F00108.1.587.862Eucgr.F02205.1.452.713
Eucgr.I01059.1Eucgr.G01773.1Eucgr.I01060.1Eucgr.I01061.1Eucgr.G01210.1
Eucgr.G01205.1Eucgr.G01215.1Eucgr.G01214.1Eucgr.G01217.1Eucgr.G01206.1
Eucgr.G01213.1Eucgr.G01209.1
Fragaria vescamrna02649.1-v1.0-hybrid.593.860mrna07626.1-v1.0-hybridmrna25505.1-v1.0-hybrid.713.976mrna25505.1-v1.0-hybrid.713.976mrna25505.1-v1.0-hybrid.713.976
mrna28152.1-v1.0-hybrid.228.491mrna25508.1-v1.0-hybrid.175.436mrna25505.1-v1.0-hybrid.226.484mrna25505.1-v1.0-hybrid.226.484mrna25505.1-v1.0-hybrid.226.484
Glycine maxGlyma14g10456.2.555.825Glyma14g10456.1.584.854Glyma06g05290.1.396.666Glyma04g05220.3.395.665Glyma04g05220.2.395.665
Glyma17g35060.2.585.853Glyma17g35060.1.556.824Glyma06g00680.1Glyma04g00610.2Glyma04g00610.1
Glyma11g11220.1.211.472Glyma11g11200.1.222.493Glyma20g27040.1Glyma10g40300.2Glyma10g40300.1
Glyma10g40293.1
Gossypium raimondiiGorai.009G223500.6.425.707Gorai.009G223500.5.565.847Gorai.009G223500.4.564.846Gorai.009G223500.3.565.847Gorai.009G223500.2.564.846
Gorai.009G223500.1.565.847Gorai.009G223600.1.421.696Gorai.010G029100.1.585.855Gorai.005G231200.1Gorai.008G020100.2
Gorai.008G020100.1Gorai.005G231100.2Gorai.005G231100.1Gorai.002G195600.1.359.528Gorai.002G195600.1.359.528
Gorai.002G195600.1.359.528Gorai.002G195600.1.168.257Gorai.002G195600.1.168.257Gorai.002G195600.1.168.257Gorai.002G195600.1.280.355
Gorai.002G195600.1.280.355Gorai.002G195600.1.280.355
Linum usitatissimumLus10007242.429.712Lus10028242.428.711Lus10025054Lus10033786.213.477Lus10014642.218.482
Lus10020985.202.471Lus10033784Lus10034490Lus10014646
Malus domesticaMDP0000225641.598.870MDP0000246856MDP0000249571MDP0000245498.229.493MDP0000144523
MDP0000779011MDP0000146624.768.905MDP0000146624.768.905MDP0000132261MDP0000146624.669.763
MDP0000146624.669.763
Manihot esculentacassava4.1_002200m.411.692cassava4.1_001250m.571.847cassava4.1_001252m.573.850cassava4.1_001320m.557.841cassava4.1_033386m
cassava4.1_029937mcassava4.1_021918m.217.482cassava4.1_021990mcassava4.1_028847mcassava4.1_026436m
Medicago truncatulaMedtr3g117800.1Medtr7g024420.1Medtr1g106800.1Medtr1g106790.1Medtr1g106910.1
Medtr1g106770.1
Mimulus guttatusmgv1a027071m.549.820mgv1a000981m.578.858mgv1a020606mmgv1a003597m.225.485mgv1a023132m
mgv1a024427mmgv1a003542mmgv1a019481mmgv1a025021mmgv1a022322m
mgv1a004157mmgv1a004760mmgv1a021702mmgv1a004887m
Oryza sativaLOC_Os03g47010.1.411.694LOC_Os01g04300.1.211.499LOC_Os01g04290.1LOC_Os05g25560.1LOC_Os05g23350.1
LOC_Os03g14010.3LOC_Os03g14010.2LOC_Os03g14010.1LOC_Os05g23924.2LOC_Os05g23924.1
LOC_Os03g10469.2LOC_Os03g10469.1LOC_Os10g21110.1LOC_Os03g10440.1.227.490LOC_Os03g10478.1.232.497
LOC_Os10g21100.1
Panicum virgatumPavirv00018091m.408.690Pavirv00043679m.401.686Pavirv00043214mPavirv00009472m.233.513Pavirv00011920m
Pavirv00064836mPavirv00011543mPavirv00004670mPavirv00012621mPavirv00003316m
Pavirv00046655mPavirv00001379mPavirv00041480mPavirv00066390mPavirv00041724m
Pavirv00066756mPavirv00064807mPavirv00011965mPavirv00070694m.721.846Pavirv00049463m
Pavirv00011967mPavirv00011966mPavirv00027101m.191.313Pavirv00026745m.214.317
Physcomitrella patensPp1s121_107V6.1.717.999
Phaseolus vulgarisPhvul.009G075400.1.397.677Phvul.001G032300.2.556.827Phvul.001G032300.1.583.854Phvul.009G120500.1Phvul.011G033100.1.217.499
Phvul.007G045400.1Phvul.007G045900.1
Picea abiesMA_9039435g0010.206.470MA_350255g0010MA_604666g0010MA_10433351g0010MA_9354042g0010
MA_429144g0010.244.407MA_8357324g0010
Populus trichocarpaPotri.002G113100.2.412.693Potri.004G173300.4Potri.004G173300.3Potri.004G173300.2Potri.004G173300.1
Potri.009G087900.1.202.466Potri.009G087800.3Potri.009G087800.2Potri.009G087800.1Potri.009G087700.2
Potri.009G087700.1Potri.009G087600.1
Prunus persicappa001089m.567.845ppa004290mppa016947mppa021363m.219.483ppa023031m
ppa024827m
Ricinus communis30170.m013644.481.75830170.m01364629492.m00007029812.m00019629812.m000195.218.483
29812.m00019429812.m00019958888.m000026
Setaria italicaSi038956m.406.689Si000821mSi000630m.297.586Si025026mSi034995m.207.495
Si001255mSi034968mSi039948mSi034867m.230.491Si039549m
Si039641mSi034912m.223.486
Selaginella moellendorffii111304.535.794420481.257.518
Sorghum bicolorSb01g012210.1.405.688Sb03g006980.1.246.530Sb03g006950.1.218.506Sb04g020543.1Sb01g041310.1
Sb06g003350.1Sb01g043760.1Sb02g004490.1Sb01g043730.1Sb01g043720.1
Thellungiella halophilaThhalv10023244m.581.848Thhalv10028466m.388.667Thhalv10024805mThhalv10027468m.221.481Thhalv10024995m.219.458
Thhalv10023172m
Vitis viniferaGSVIVT01009272001.602.834GSVIVT01024049001GSVIVT01037833001.244.520GSVIVT01037833001.244.520GSVIVT01037832001
GSVIVT01037825001.197.461
Volvox carteriVocar20000377mVocar20006952m
Zea maysAC204711.3_FGT002
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)