y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.007G093200.1
FamilyAA1
Protein PropertiesLength: 293 Molecular Weight: 32035.7 Isoelectric Point: 9.4686
ChromosomeChromosome/Scaffold: 07 Start: 9524283 End: 9525510
DescriptionLaccase/Diphenol oxidase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA172920
  GEWWKSNTEAVINEALKSGLAPNVSDAHTINGHPGPVQGCASQERFKLDVQLGNTYLLRIIDAALNEELFFKIAGHKLTLVEVDAVYTKPFKTYTIVITP
  GQTTNVLLTTKHAAGKYLVAASPFMDAPIAVDNKTATATLHYSGTLSSNLTTLTSMPPKNSTILATSFTDSLRSLNSKKYPARVPLKIDRNLLFTVSLGI
  NPCSTCVNNSRVVADINNVTFVMPKISLLQAHFFKIKGVFTDDFPGNPPVFYNFTGTQPSNLNTVTGTKLYRLAYNSTVQLVLQDT
Full Sequence
Protein Sequence     Length: 293     Download
MTRTQCGEWW KSNTEAVINE ALKSGLAPNV SDAHTINGHP GPVQGCASQE RFKLDVQLGN    60
TYLLRIIDAA LNEELFFKIA GHKLTLVEVD AVYTKPFKTY TIVITPGQTT NVLLTTKHAA    120
GKYLVAASPF MDAPIAVDNK TATATLHYSG TLSSNLTTLT SMPPKNSTIL ATSFTDSLRS    180
LNSKKYPARV PLKIDRNLLF TVSLGINPCS TCVNNSRVVA DINNVTFVMP KISLLQAHFF    240
KIKGVFTDDF PGNPPVFYNF TGTQPSNLNT VTGTKLYRLA YNSTVQLVLQ DTQ           300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02792PLN027929.0e-147246249+
PLN02604PLN026042.0e-1451291248+
TIGR03388ascorbase3.0e-1746291258+
pfam00394Cu-oxidase1.0e-377148146+
TIGR03389laccase1.0e-1457292291+
Gene Ontology
GO TermDescription
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAC49536.108292164450diphenol oxidase [Nicotiana tabacum]
RefSeqXP_002280416.107292162447PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002299828.107292162447predicted protein [Populus trichocarpa]
RefSeqXP_002314124.107292164449predicted protein [Populus trichocarpa]
RefSeqXP_002520425.108292165449laccase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B0.00000000137291189433A Chain A, Human Beta-Hexosaminidase B
PDB1asq_A0.00000000137291189433A Chain A, Human Beta-Hexosaminidase B
PDB1asp_B0.00000000137291189433A Chain A, Human Beta-Hexosaminidase B
PDB1asp_A0.00000000137291189433A Chain A, Human Beta-Hexosaminidase B
PDB1aso_B0.00000000137291189433A Chain A, Human Beta-Hexosaminidase B
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX27713029232920
DY29471228882930
EL35918926172650
FC89574925282570
HO79767529272920
Orthologous Group
SpeciesID
Glycine maxGlyma06g43701.1
Linum usitatissimumLus10040226
Medicago truncatulaMedtr5g081790.1
Phaseolus vulgarisPhvul.009G027800.1Phvul.001G122100.1
Picea abiesMA_6005856g0010MA_7461249g0010MA_10435604g0010MA_1991g0010MA_9916300g0010
Vitis viniferaGSVIVT01033192001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny