y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.007G102400.1
FamilyCBM57
Protein PropertiesLength: 647 Molecular Weight: 70672.3 Isoelectric Point: 6.5946
ChromosomeChromosome/Scaffold: 07 Start: 11505244 End: 11509977
DescriptionDi-glucose binding protein with Leucine-rich repeat domain
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM572363792.4e-22
  TDRFARSWQPDSAFRTIPQYSNDVSFLSTANSISGADEEPNYFPMKVYQSAVTTEGTLEYELGVDAKMDYAVWLHFAEIDSSVKKAGERVFDVFINGDNV
  TRLDIYKQVGGFSALTLNYTLKNLSSNVFTLKLVPAVGAPLISG
Full Sequence
Protein Sequence     Length: 647     Download
MTSLFFISFF FSFFLFFFTI PITTSAPPPP PPPPPPPPPP PYPYGFSYHI NCGTSANSTD    60
SFNTTWLSDR FFSAGSSALV SQPLNFPLPS EKTLRFFPSS SYGKKNCYTF PSLPSSSRYL    120
LRTFTVYDNY DAKSRPPSFD VSLSSTVIFS WRSPWPESTA AKGAYSDLFA SLSNTSSSLD    180
LCFYGFATDA PLVSSLELIQ VHPAAYGASD NTILVNYGRI SCGAPHHWGA AFSNDTDRFA    240
RSWQPDSAFR TIPQYSNDVS FLSTANSISG ADEEPNYFPM KVYQSAVTTE GTLEYELGVD    300
AKMDYAVWLH FAEIDSSVKK AGERVFDVFI NGDNVTRLDI YKQVGGFSAL TLNYTLKNLS    360
SNVFTLKLVP AVGAPLISGV ENYALVPLDP STLPLQATAM KALKESLRVP DRMGWNGDPC    420
APTTWDAWEG VTCRMTTDKT ALVISEIDLS TQGLKGYISD QISLLSNLVS LNLSSNSLAG    480
GIPPGLGQKS LIQVDLSNNQ LTGTIPEGLA SSNLKLVLLN GNRLEGRVPE QLYSVGVHGG    540
AIDLSGNKGL CGVPSLPSCP IFWEHGRLST WGKLAIGLSC VFVLCVALLL AYIYIRRKRN    600
DYDFALPHEL MSLAAKRNRY QRQKSLMLLE LESQHAKGLP SLFTPL*                  660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam11721Malectin0.009477731+
PLN00113PLN001139.0e-747953256+
pfam11721Malectin1.0e-16219380176+
pfam12819Malectin_like6.0e-5050383358+
PLN03150PLN031504.0e-9846559537+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001041980.104363831630Os01g0140400 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_564237.204364225623leucine-rich repeat protein-related [Arabidopsis thaliana]
RefSeqXP_002281668.104264125621PREDICTED: similar to leucine-rich repeat protein-related [Vitis vinifera]
RefSeqXP_002457393.104763929625hypothetical protein SORBIDRAFT_03g006620 [Sorghum bicolor]
RefSeqXP_002524408.104361719591serine-threonine protein kinase, plant-type, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3rgz_A0.000003447559637748A Chain A, Crystal Structure Of Nasturtium Xyloglucan Hydrolase Isoform Nxg2
PDB3rgz_A0.0002443530395508A Chain A, Crystal Structure Of Nasturtium Xyloglucan Hydrolase Isoform Nxg2
PDB3rgz_A0.0002443529224311A Chain A, Crystal Structure Of Nasturtium Xyloglucan Hydrolase Isoform Nxg2
PDB3rgz_A0.0003447509495558A Chain A, Crystal Structure Of Nasturtium Xyloglucan Hydrolase Isoform Nxg2
Transmembrane Domains
StartEnd
527
574596
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE6137922613025620
EY0801462563225770
EL3519622553235770
GO9209872741954620
EH7649922593626200
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01105.1Aquca_026_00194.1Aquca_036_00074.1
Arabidopsis thalianaAT1G28340.1
Brachypodium distachyonBradi1g26830.1
Brassica rapaBra032897
Carica papayaevm.model.supercontig_27.21
Capsella rubellaCarubv10008578m
Citrus clementinaCiclev10014874mCiclev10014609m
Citrus sinensisorange1.1g013887morange1.1g012913morange1.1g010819morange1.1g009515morange1.1g007860m
orange1.1g007307morange1.1g006793morange1.1g015373morange1.1g009603morange1.1g009236m
orange1.1g006940morange1.1g006035m
Cucumis sativusCucsa.147330.1Cucsa.126850.1
Eucalyptus grandisEucgr.G02346.3Eucgr.E03253.2Eucgr.E03253.1Eucgr.D00605.1
Fragaria vescamrna03872.1-v1.0-hybridmrna29734.1-v1.0-hybrid
Glycine maxGlyma02g11090.2Glyma02g11090.1Glyma01g22406.1Glyma20g32720.1Glyma15g08350.4
Glyma15g08350.3Glyma13g31020.4Glyma13g31020.3Glyma13g24550.1Glyma07g31970.1
Glyma07g31970.2
Gossypium raimondiiGorai.005G138000.3Gorai.005G138000.2Gorai.005G138000.1Gorai.011G029600.2Gorai.011G029600.1
Gorai.006G087900.8Gorai.006G087900.7Gorai.006G087900.6Gorai.006G087900.5Gorai.006G087900.4
Gorai.006G087900.3Gorai.006G087900.2Gorai.006G087900.1
Linum usitatissimumLus10041488Lus10034275Lus10015417Lus10013994Lus10015320
Malus domesticaMDP0000298053MDP0000124675
Manihot esculentacassava4.1_031190mcassava4.1_008047mcassava4.1_003726mcassava4.1_003546mcassava4.1_034042m
Medicago truncatulaMedtr5g053610.1Medtr2g014290.1
Mimulus guttatusmgv1a002935m
Oryza sativaLOC_Os07g31840.1
Panicum virgatumPavirv00022924mPavirv00022923mPavirv00008373m
Physcomitrella patensPp1s83_48V6.1Pp1s199_124V6.1Pp1s5_311V6.1Pp1s1_97V6.1Pp1s2_327V6.1
Pp1s6_364V6.1
Phaseolus vulgarisPhvul.003G027500.1Phvul.006G183300.2Phvul.006G183300.1Phvul.002G230800.1Phvul.003G239400.1
Picea abiesMA_199958g0010MA_41304g0010
Populus trichocarpaPotri.010G129300.3Potri.010G129300.2Potri.010G129300.1Potri.008G117000.2Potri.008G117000.1
Potri.011G056800.2Potri.011G056800.1Potri.004G047300.4Potri.004G047300.3Potri.004G047300.2
Potri.004G047300.1
Prunus persicappa002857mppa003081m
Ricinus communis29738.m00104930190.m011324
Setaria italicaSi029205m
Selaginella moellendorffii133089
Sorghum bicolorSb02g034070.1
Thellungiella halophilaThhalv10007074m
Vitis viniferaGSVIVT01021096001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)